Recombinant Human Myelin and lymphocyte protein (MAL)

Code CSB-CF013372HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MAL
Uniprot No.
Alternative Names
MAL; Myelin and lymphocyte protein; T-lymphocyte maturation-associated protein
Species
Homo sapiens (Human)
Expression Region
1-153
Target Protein Sequence
MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could be an important component in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane. Could be involved in myelin biogenesis and/or myelin function.
Gene References into Functions
  1. In high-grade serous ovarian carcinoma patients, MAL was overexpressed in platinum-resistant compared to platinum-sensitive patients and resulted as an independent prognostic marker of survival. PMID: 28545541
  2. MAL and TMEM220 were specifically methylated and were down-regulated in human gastric cancer. PMID: 27329150
  3. This study revealed that Merkel cell polyomavirus -negative Merkel cell carcinomas significantly expressed higher CADM1 and lower MAL than Merkel cell polyomavirus -positive Merkel cell carcinomas PMID: 26772392
  4. CADM1/MAL methylation increases with severity of cervical intraepithelial neoplasia PMID: 26219541
  5. Hypermethylation of the selected markers (MAL, PRIMA1, PTGDR and SFRP1) can result in reduced gene expression and may contribute to the formation of colorectal cancer. PMID: 26482433
  6. Data suggest that expression of MAL in cells confers both ETX (Clostridium perfringens epsilon-toxin) binding and susceptibility to ETX-mediated cell death; cells expressing rat MAL are 100 times more sensitive to ETX than cells expressing human MAL. PMID: 25993478
  7. The use of CADM1, MAL, and MIR124-2 as biomarkers for full molecular screening in HIV infected women who are also positive for human papillomavirus. PMID: 26473640
  8. MAL is a critical element of the machinery for exosome secretion and may constitute a target for modulating exosome secretion by human T cells. PMID: 26109641
  9. MAL hypermethylation is associated with esophageal carcinoma progression. PMID: 24088706
  10. Cytology and bi-marker CADM1/MAL-methylation analysis perform complementary for CIN2+/CIN3+ detection when used as triage tool on cervical scrapes of HPV positive women. PMID: 25667975
  11. DNA methylation analysis of CADM1, MAL and miR124-2 in cervical scrapes consistently detects cervical cancer PMID: 25281766
  12. The MAL gene repression related with lymph node metastasis and poor prognosis in gastric cancer, suggesting that the MAL may be a new candidate node metastasis-suppressor gene for gastric cancer. PMID: 24511665
  13. CADM1 and MAL methylation levels increased proportional to severity of the underlying lesion PMID: 23456988
  14. hypomethylation of LINE-1 and hypermethylation of SLIT2, MAL and IGFBP7 were frequently detected in NSCLCs and associated with various clinical features. PMID: 23381221
  15. MAL protein plays an important role during oral carcinogenesis, MAL gene expression was significantly decreased in oral squamous cell carcinoma compared with normal epithelium. PMID: 23224601
  16. Data indicate that DNA methylation status of multiple genes CADM1, MAL and hsa-miR-124-2 was analyzed in human papillomavirus (hrHPV)-positive cervical scrape. PMID: 23176198
  17. the methylation marker panel CADM1-M18 and MAL-M1 may serve as an alternative molecular triage tool for hrHPV-positive women. PMID: 21190187
  18. Data show that a combination of CADM1 and MAL methylation could represent a promising candidate triage tool for hrHPV-positive women. PMID: 21389098
  19. MAL is normally expressed in laryngeal epithelial cells and its expression changes at early stages of carcinoma development. PMID: 19670627
  20. This study supports roles for tyrosines 86 and 106 in signaling pathways involving MAL. PMID: 20822478
  21. Data suggest that the epigenetic inactivation of MAL, as a candidate tumor suppressor gene, can contribute to human epithelial cell carcinoma and may be served as a biomarker in HNSCC. PMID: 21092172
  22. The caspase-1 cleavage site in Mal is part of a TIR-domain interaction site. PMID: 20048342
  23. Data show that MAL transcript levels were higher in the resistant ovarian cell lines. PMID: 19642140
  24. The mal gene which is switched-off in all esophageal squamous cell carcinoma samples can be considered as a tumor suppressor gene PMID: 15188492
  25. Caveolin-1 and MAL are located on prostasomes secreted by prostate cancer cells PMID: 15466889
  26. Quantitative analysis carried out using pixel intensity variance demonstrated that the MAL protein is capable of modifying the plasma membrane, thereby increasing its resistance to detergent-induced pore formation. PMID: 16785208
  27. Loss of MAL expression is aasociated with precancerous lesions of the esophagus PMID: 17151798
  28. Promoter hypermethylation of MAL, shown to be present in colorectal adenomas and carcinomas and only rarely in normal mucosa. PMID: 17408629
  29. promoter hypermethylation of MAL was present in the vast majority of benign and malignant colorectal tumors, and only rarely in normal mucosa PMID: 18346269
  30. MAL has a putative tumour-suppressor gene function in gastric cancer, and detection of promoter hypermethylation may be useful as a prognostic marker. PMID: 19002170
  31. Inactivation of the MAL gene in breast cancer is a common event that predicts benefit from adjuvant chemotherapy. PMID: 19208741
  32. suggesting the MAL gene as a new metastasis-suppressor candidate for head and neck cancer PMID: 19445022

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
MAL family
Database Links

HGNC: 6817

OMIM: 188860

KEGG: hsa:4118

STRING: 9606.ENSP00000310880

UniGene: Hs.80395

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×