Recombinant Human Neuronal acetylcholine receptor subunit alpha-4(CHRNA4)-VLPs

In Stock
Code CSB-MP005390HU(A4)
Abbreviation Recombinant Human CHRNA4 protein-VLPs
MSDS
Size
Order now
Image
  • CSB-MP005390HU(A4) is detected by Mouse anti-6*His monoclonal antibody
  • The purity of VLPs was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-627aa
Target Protein Sequence
HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodium ions.
Gene References into Functions
  1. cryoelectron microscopy and the structural principles of distinct assemblies of the human alpha4beta2 nicotinic receptor PMID: 29720657
  2. Results are comparable to the impact of nicotine on withdrawal-related impaired plasticity in smokers and suggest that alpha4beta2 nicotinic receptors are relevantly involved in plasticity deficits and restitution in smokers. PMID: 28469204
  3. Orienting attention predicted by CHRNA4 and maternal sensitivity interaction in 6-month-old infants. PMID: 28582665
  4. This study demonstrated that rs1044396 of CHRNA4 was significantly associated with Internet gaming disorder PMID: 29240768
  5. the mechanism of interaction between [Upsilon4E]GID and the agonist binding pockets of the alpha4beta2 and the halpha7 receptors, and to estimate their relative binding affinities, was investigated. PMID: 27721068
  6. Reactive oxygen species, generated by 6-hydroxydopamine (6-OHDA), could cause the current rundown in alpha4beta2 nAChRs, which may play a role in Parkinson disease. PMID: 27445102
  7. As well as basal forebrain and brainstem cholinergic system dysfunction, cholinergic deficits mediated through nicotinic acetylcholine receptors could be evident within key networks in AD. PMID: 27565302
  8. A polymorphism in CHRNA4 leads to an overdominant effect at this locus, with higher activity in the cingulo-opercular network underlying alertness. PMID: 28877969
  9. Ability to navigate in the wilderness benefits from heightened ability to focus attention (CHRNA4). PMID: 27123786
  10. Data suggest that amino acid residues alpha4Gly-41, alpha4Lys-64, and alpha4Thr-66 are critical for (alpha4)3(beta2)2 neuronal AChR potentiation by positive allosteric modulator (PAM) CMPI, but not by PAM NS9283; amino acid substitution at alpha4His-116, a known determinant of NS9283 binding and of agonist binding at alpha4:alpha4 subunit interface, did not reduce CMPI potentiation. PMID: 28446611
  11. This study shows that unorthodox acetylcholine binding sites can form at the alpha5/alpha4 and beta3/alpha4 interfaces in (alpha4beta2)2alpha5 and (alpha4beta2)2beta3 nicotinic acetylcholine receptors (nAChRs) and at the alpha4/alpha5 in (beta2alpha4)2alpha5 nAChRs. PMID: 27645992
  12. the role of CHRNA4 and CHRNA7 genetic polymorphisms in moderating auditory target and novelty attentional processing in healthy subjects exposed to the auditory "oddball" P300 paradigm. PMID: 27109789
  13. The form containing three copies of alpha4 and two of beta2 was potentiated at low concentrations of acetylcholine chloride (ACh) and physostigmine, whereas the form containing two copies of alpha4 and three of beta2 was inhibited. PMID: 27895161
  14. X-ray crystallographic structure of the human alpha4beta2 nicotinic receptor, the most abundant nicotinic subtype in the brain; structure provides insights into the architectural principles governing ligand recognition, heteromer assembly, ion permeation and desensitization in this prototypical receptor class PMID: 27698419
  15. findings indicate that alterations in expression of the alpha4beta2 subtype of nAChR may be involved in the molecular mechanism(s) underlying the cognitive deficit associated with vascular dementia PMID: 26858154
  16. Study presented several lines of evidence for the role of a variant encoding CHRNA4 R336C in smoking behavior and risk of smoking-related diseases PMID: 26952864
  17. Prepulse inhibition may be influenced by the polymorphisms of the CHRNA4 in schizophrenia and it may be a potential endophenotype of schizophrenia. PMID: 26982087
  18. Study observed a significant association between the rs1044396 SNP in the CHRNA4 gene and the personality trait harm avoidance PMID: 26612384
  19. Results provide further evidence that common synonymous CHRNA4 exon 5 SNPs affect cognitive processes and suggest that they also play a role in the auditory system. PMID: 27054571
  20. Common CHRNA4 variant with important regulatory properties that contributes to nicotine dependence and smoking-related consequences was identified. PMID: 26440539
  21. Data show alpha4 subunit role in conferring potentiation by 17beta-estradiol (BEST) and indicate that the C-terminal region is involved in both binding of betaEST and potentiation, while the N-terminal domain seems involved in enhancing its efficacy. PMID: 26684647
  22. the identity of subunits neighboring the otherwise equivalent alpha4(+)/(-)beta2 agonist sites modifies their contributions to nAChR activation and E-loop residues are an important contributor to this neighbor effect PMID: 26644472
  23. findings demonstrate that the complementary alleles of the CHRNA4 exon 5 haplotype differ with respect to mRNA stability, codon usage and agonist sensitivity PMID: 25934188
  24. CHRNA4 rs1044396 CT/TT genotype is related to cigarette smoking in Parkinson's disease patients. PMID: 26125703
  25. study demonstrated that genetic variation of CHRNA4 (rs1044396) increased blink rate while watching a video; suggests that differences in sensitivity to acetylcholine because of the genetic variation are associated with individual differences in spontaneous eye blink rate PMID: 25729002
  26. Study investigated whether the rs1044396 polymorphism of the CHRNA4 gene modulates response speed and selective visual attention in the Stroop task, Negative priming task, and Posner-Cuing task in n = 157 healthy participants PMID: 25639542
  27. analysis of how an agonist to the binding site promotes activation of alpha4beta2* nicotinic acetylcholine receptors PMID: 25869137
  28. Description of a de novo missense mutation in the transmembrane domain M2 segment of CHRNA$, c.823A>T, which decreased the surrounding hydrophobicity and slightly altered secondary structure of the protein PMID: 25282705
  29. Data indicate the binding mode and modulatory mechanism of NS9283 at alpha4beta2 nicotinic acetylcholine receptors. PMID: 24982426
  30. Variants in CHRNA4 may contribute to risk of binge drinking in young adults. PMID: 24428733
  31. There were no effects of CHRNA4 or DAT1 on either facilitation or inhibition of return. PMID: 23731290
  32. A significant association between CHRNA4 variants and a subgroup of smokers. PMID: 24498031
  33. Smokers with less upregulation of available alpha4beta2* nAChRs have a greater likelihood of quitting with treatment than smokers with more upregulation. PMID: 24850280
  34. Our findings demonstrate, for the first time, that genetic variations in CHRNA4 can moderately contribute to individual differences in natural-scene categorization performance. PMID: 23720086
  35. findings suggest that CHRNB2 rs4845652 T-allele carriers may be associated with lower levels of nicotine dependence (ND), and that certain allelic combinations of CHRNA4 and CHRNB2 might be correlated with higher ND levels. PMID: 23037950
  36. significant effects of the alpha4 variants on nAChR expression, subcellular distribution, and sensitivity to nicotine-induced receptor upregulation. PMID: 24385388
  37. The results have excluded the involvement of any known mutations of the CHRNA4 gene. PMID: 24327142
  38. Data indicate that compounds showed favorable subtype selectivity for beta2*-nAChRs over beta4*-nAChRs. PMID: 23734673
  39. Smoking reduction and cessation lead to decreased alpha4beta2* nAChR densities across brain regions. PMID: 23429692
  40. Variation in CHRNA4 appears to contribute to child personality by affecting degree of developmental sensitivity to both normal and adverse environments. PMID: 23240931
  41. Nicotinic acetylcholine receptor subunits alpha4 and alpha5 associated with smoking behavior and lung cancer are regulated by upstream open reading frames. PMID: 23843950
  42. rs755203 and rs1044397 in CHRNA4 might play a role in the pathophysiology of nicotine dependence in healthy controls in the Japanese population PMID: 23553665
  43. SNPs in CHRNA4 associate with DSM -IV nicotine dependence symptom counts in young adults. PMID: 23350800
  44. alpha4beta2-nAChR is a sensitive target to mediate oligomeric alpha-synuclein-induced modulation of cholinergic signaling. PMID: 23437071
  45. We found significantly reduced gray matter volume in the right putamen in carriers of the DRD2 C/C and CHRNA4 T/T groups. PMID: 22947540
  46. Data indicate that both acetylcholine and nicotine showed much attenuated interaction with alpha4beta4 receptor. PMID: 23349463
  47. NMR resolved multiple anesthetic binding sites in the TM domains of the alpha4beta2 nAChR PMID: 23000369
  48. The T- variant (CC genotype) of the rs1044396 polymorphism on the CHRNA4 gene exerts pleiotropic effects on a vast range of behaviors, including cognition, emotion, and addiction PMID: 22722381
  49. the present data confirm that CHRNA4 variants are overrepresented in SALS strengthening the hypothesis can they act as predisposing genetic factors for ALS. PMID: 22873564
  50. Data indicate that cytisine, varenicline, and nicotine are all high affinity binders for the alpha4beta2 nAChRs, but all display lower affinity for the alpha7 subtype receptor. PMID: 22553201

Show More

Hide All

Involvement in disease
Epilepsy, nocturnal frontal lobe, 1 (ENFL1)
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-4/CHRNA4 sub-subfamily
Database Links

HGNC: 1958

OMIM: 118504

KEGG: hsa:1137

STRING: 9606.ENSP00000359285

UniGene: Hs.10734

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*