Recombinant Human Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5)

Code CSB-CF005391HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CHRNA5
Uniprot No.
Alternative Names
CHRNA5; NACHRA5; Neuronal acetylcholine receptor subunit alpha-5
Species
Homo sapiens (Human)
Expression Region
23-468
Target Protein Sequence
RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQ LVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGR FEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIIL EDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCI GLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMI FVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLLCMRSHVDRYFTQKEETES GSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLDRMFLWTFLFVSIVG SLGLFVPVIYKWANILIPVHIGNANK
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Gene References into Functions
  1. Glutamatergic N398 neurons responded to lower nicotine doses (0.1 muM) with greater frequency and amplitude but they also exhibited rapid desensitization, consistent with previous analyses of N398-associated nicotinic receptor function PMID: 27698409
  2. Increased habenula-striatum functional connectivity may be modulated by the nicotinic receptor variant rs16969968 and may lead to increased Opioid use. PMID: 28857330
  3. Our present study suggested that rs667282 in CHRNA5-A3 may modify the prognosis of patients with advanced non-small cell lung cancer PMID: 27050379
  4. The data replicate previous result suggesting CHRNA5 as a candidate gene for chronic obstructive pulmonary disease (COPD) and rs8040868 as a risk variant for the development of COPD in the Swedish population. PMID: 27835950
  5. Polymorphisms in the CHRNA5 and NRXN1 genes, influenced greater consumption of cigarettes in a Mexican Mestizo population. PMID: 27355804
  6. RP11-650L12.2 rs149941240 polymorphism was associated with the risk of colorectal cancer. PMID: 28442398
  7. We determined that the other patients harbored mutations in genes that have not previously been linked to RTT or other neurodevelopmental syndromes, such as the ankyrin repeat containing protein ANKRD31 or the neuronal acetylcholine receptor subunit alpha-5 (CHRNA5). PMID: 27541642
  8. quitting smoking is highly beneficial in reducing lung cancer risks for smokers regardless of their CHRNA5 rs16969968 genetic risk status. Smokers with high-risk CHRNA5 genotypes, on average, can largely eliminate their elevated genetic risk for lung cancer by quitting smoking- cutting their risk of lung cancer in half and delaying its onset by 7years for those who develop it. PMID: 27543155
  9. Study showed that multiple rare, low frequency and common variants in the CHRNA5 gene contribute to the development of nicotine dependence PMID: 26239294
  10. There was no association of rs16969968 polymorphism at CHRNA5 with cancer risk in the overall pooled analysis PMID: 27072204
  11. rs2036527 is a risk factor for smoking exposure and lung cancer association in African-Americans. PMID: 26981579
  12. Preventive interventions in adolescents reduced the genetic risk for smoking from rs16969968 CHRNA5. PMID: 25941207
  13. suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers PMID: 26689306
  14. These results suggest that exposure to nicotine might negatively impact the apoptotic potential of chemotherapeutic drugs and that alpha5-nAChR/AKT signaling plays a key role in the anti-apoptotic activity of nicotine induced by cisplatin. PMID: 26909550
  15. A novel regulatory SNP association with nicotine dependence was found. Previously observed differences in CHRNA5 mRNA expression and nicotine dependence risk were connected to underlying DNA methylation differences. PMID: 26220977
  16. Our meta-analysis provided statistical evidence for a strong association between rs16969968 polymorphism and the risk of lung cancer, especially in smokers and Caucasians. PMID: 26434895
  17. This study showed that CHRNA5(rs16969968) interacted with chronic low family support in association with child mental health status PMID: 26228411
  18. No associations were found between the analyzed variants and smoking, however, there was an association among non-smoking subjects between the A allele of rs16969968 and high body mass index. PMID: 26757861
  19. In non-Hispanic White participants, a novel association between rs1289899 in the CHRNA5 gene and posttraumatic stress disorder was observed. PMID: 26184988
  20. A low to moderate level of Nicotine Dependence in the Kashubians, of Poland, influenced by age, sex, as well as the CHRNA5 rs16969968 variant was demonstrated PMID: 25652844
  21. Results indicate that the minor alleles of both polymorphisms modulate response speed in a sex-dependent, diametrically opposed manner. PMID: 25674902
  22. The CHRNA5 genetic risk synergized the effect of partner smoking, producing an especially low likelihood of successful smoking reduction in two complementary studies. PMID: 25073833
  23. CHRNA5 rs3841324 combined variant genotypes (ins/del+del/del) had a >1.5-fold elevated risk for nasopharyngeal carcinoma PMID: 25329654
  24. Genetic variation in CHRNA5 protein influence smoking behaviors and the level of carbon monoxide. PMID: 25072098
  25. CHRNA5 SNPs predicted nicotine deprivation-induced reduction in cognitive control. PMID: 24934182
  26. Among smokers who are hospitalized with acute myocardial infarction, the high-risk CHRNA5 allele was associated with lower likelihood of quitting before hospitalization and significantly less abstinence 1 year after hospitalization with MI. PMID: 24727484
  27. The effect of nicotine replacement on continuous abstinence is moderated by the combined genetic risks from CYP2A6 and CHRNA5. PMID: 24033696
  28. Single nucleotide polymorphism in CHRNA5 is associated with lung cancer. PMID: 25187487
  29. Data found that DRD2 rs1076560 and CHNRA5 rs16969968 interact to modulate cognitive function, prefrontal physiology during working memory, and prefrontal gray matter volume. PMID: 24819610
  30. in African-Americans, variants (common or rare) in genes other than CHRNA5 most likely contribute toward the nicotine-dependent phenotype. PMID: 24682045
  31. substance dependence associated variants have a direct cis-regulatory effect on CHRNA5 transcript levels in human frontal cortices of African and European ancestry. PMID: 24303001
  32. Among African Americans, CHRNA5-A3-B4 variants are not associated with smoking but can influence smoking abstinence. PMID: 24733007
  33. The present study investigated the association of CHRNA5 polymorphisms and smoking topography. PMID: 23358500
  34. the heterozygous genotype c.-166T>A at rs503464 of CHRNA5 may be associated with reduced risk of lung cancer, thus representing a susceptibility allele in Chinese individuals. PMID: 23314339
  35. Silencing of alpha5-nAChR significantly inhibits nicotine-induced cell proliferation in tumor cell lines. PMID: 24793809
  36. Women with the variant AA genotype of CHRNA5 rs16969968 or variant CC genotype of LOC123688 rs8034191 were at significantly increased risk of heavy smoking. PMID: 21810735
  37. the alpha5 subunit can occupy the position of a nonbinding subunit, or replace a beta2 subunit participating in a canonical binding site. PMID: 24184962
  38. CHRNA5 polymorphism was associated with pack-year of smoking in chronic obstructive pulmonary disease Chinese Han patients PMID: 22914670
  39. Evaluated the association between CHRNA5-A3-B4 gene cluster variants (rs667282 and rs3743073, two variants modifying lung cancer risk) and risk of gastric cancer. PMID: 23576140
  40. The rs588765 nicotine dependence risk allele 'C' was associated with delayed age at onset among ever-smokers(even when smoking intensity variables are accounted for), but had no significant effect among never smoked. PMID: 22884254
  41. our findings provide evidence for the presence of multiple CHRNA5 mRNA isoforms that may modulate the multimeric nicotine receptor and cis-regulatory variations in the CHRNA5 locus that act in vivo in the control of CHRNA5 mRNA expression PMID: 23430818
  42. Single-nucleotide polymorphism in the CHRNA5 gene is associated with lung cancer susceptibility. PMID: 23221128
  43. Findings of this study suggest that personality measures may play an important role in substance use disorders on both environmental (marriage) and genetic rs16969968 in CHRNA5 levels. PMID: 23308091
  44. Nicotinic acetylcholine receptor single nucleotide polymorphism is associated with response to smoking cessation therapies. PMID: 23249876
  45. The intronic rs871058, that is highly correlated with rs16969968 in CHRNA5, while shows a modest treatment effect for subjects who possess the rare allele has a large effect for not carriers. PMID: 23061658
  46. results showed that several of the polymorphisms and their haplotypes in CHRNA5/CHRNA3 genes may have functional effects on (i) CHRNA5 mRNA levels, (ii) polycyclic aromatic hydrocarbon-DNA adduct levels, (iii) susceptibility to lung cancer PMID: 23011884
  47. alpha3beta4alpha5 nicotinic acetylcholine receptors, expressing the the N398 variant of CHRNA5, exhibits a reduced response to agonists when extracellular calcium is high and it may lead to distinct downstream cellular signaling. PMID: 22820273
  48. Two specific aspects of executive functioning related to drug addiction--impulsivity and working memory--are demonstrated in transgenic mice overexpressing alpha3/alpha5/beta4 nicotinic receptor subunits. PMID: 22024278
  49. The A allele of the single nucleotide polymorphism rs16969968 (alpha5, G > A), which correlates with the development of lung cancer, shows a non-significant trend to be associated with cervical lesions. PMID: 22406075
  50. Results suggest important role for CHRNA5 variants as genetic risk factor for airflow obstruction that may be independent of smoking status. PMID: 22837378

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-5/CHRNA5 sub-subfamily
Database Links

HGNC: 1959

OMIM: 118505

KEGG: hsa:1138

STRING: 9606.ENSP00000299565

UniGene: Hs.1614

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1