Recombinant Human Neuropeptide FF receptor 2 (NPFFR2)

Code CSB-CF015983HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
NPFFR2; GPR74; NPFF2; NPGPR; Neuropeptide FF receptor 2; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77; Neuropeptide G-protein coupled receptor
Species
Homo sapiens (Human)
Expression Region
1-522
Target Protein Sequence
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103. PMID: 26211894
  2. The NPFF2 neuropeptide FF receptor phosphorylation sites have been mapped and their role identified in receptor regulation. PMID: 25326382
  3. These data show that NPFF-induced heterologous desensitization of MOP receptor signaling is mediated by GRK2 and could involve transphosphorylation within the heteromeric receptor complex. PMID: 22375000
  4. Four genetic loci were strongly and independently associated with obesity, NPY2R, NPFFR2, MC4R, and FTO. PMID: 21818152
  5. Besides regulation of reproduction, kisspeptins have a potential to mediate physiological effects on autonomic regulation and nociception in humans via the NPFF2R pathways. PMID: 20600636
  6. species-related differences in the binding properties of NPFF(2) receptors PMID: 19944730
  7. Evidence does not support the hypothesis that NPGPR is involved in feeding regulation. PMID: 12609745
  8. The BIBP3226 and PFR(Tic)amide, on Human neuropeptide FF receptor subtype 2 (hNPFF2) were investigated. PMID: 15127947
  9. neuropeptide FF analogs show that NPFF2 receptors couple to the four subunits assayed. PMID: 15608144
  10. expression of hNPFF2 receptor mRNA was up-regulated by neuropeptide FF PMID: 16336216
  11. NPFF system may also have species-specific features since the NPFF2 receptor mRNA expression differs from that reported for rat PMID: 17157836
  12. findings suggest that a common haplotype in the GPR74 gene protects against obesity, which, in part, is caused by a relief of inhibition of lipid mobilization from adipose tissue PMID: 17503329
  13. we identified hFF2 positive neurons in the forebrain and medulla oblongata of individuals who died suddenly. PMID: 18565622

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Isoform 1 is abundant in placenta. Relatively highly expressed in thymus, testis, and small intestine. Expressed at low levels in several tissues including spleen, prostate, brain, heart, ovary, colon, kidney, lung, liver and pancreas and not expressed in
Database Links

HGNC: 4525

OMIM: 607449

KEGG: hsa:10886

STRING: 9606.ENSP00000307822

UniGene: Hs.99231

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1