Recombinant Human Neuropeptide S receptor (NPSR1)

Code CSB-CF757818HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
NPSR1; GPR154; GPRA; PGR14; Neuropeptide S receptor; G-protein coupled receptor 154; G-protein coupled receptor PGR14; G-protein coupled receptor for asthma susceptibility
Species
Homo sapiens (Human)
Expression Region
1-371
Target Protein Sequence
MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH EMQILSKPEFI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for neuropeptide S (NPS). Promotes mobilization of intracellular Ca(2+) stores. Inhibits cell growth in response to NPS binding. Involved in pathogenesis of asthma and other IgE-mediated diseases.
Gene References into Functions
  1. A decreased risk of psychological stress was only found in TT of NPSR1 (rs324981): A allele carriers vs. TT genotype (OR 1.64, 95% CI 1.11, 2.42), and AT genotype vs. TT genotype (OR 1.76, 95% CI 1.17, 2.65). We found that the NPSR1 (rs324981) T/T genotype decreased the risk of psychological stress, while the overall coping style was a risk factor for psychological stress. PMID: 30242809
  2. Results show higher fronto-limbic connectivity in adolescent A allele carriers vs. children carrying the A allele, a pattern which could not be discerned in TT homozygotes. Adolescent NPSR1 TT risk genotype carriers vs. adolescent A allele carriers displayed a reduced fronto-amygdala and fronto-insula effective connectivity suggesting basis of risk-increasing effect of the NPSR1T allele for anxiety. PMID: 26503268
  3. Sequence variation in NPSR1 may contribute to sex differences in stress regulation. PMID: 27883964
  4. we have utilized a broad-scaled affinity proteomics approach to identify three proteins (CCL5, HPGDS, and NPSR1) with altered plasma levels in asthmatic children compared to healthy controls, representing the first evaluation of HPGDS and NPSR1 in plasma. PMID: 27145233
  5. The interaction between 5-HTT (LL) and BDNF (A+) increased the risk of anxiety, and the interaction between BDNF (A+, GG) and NPSR1 (AA, T+) increased the risk of depression in asthmatic patients. PMID: 27176146
  6. findings demonstrate that hNPS-(1-10) is a biased agonist favoring Galphaq-dependent signaling. It may represent a valuable chemical probe for further investigation of the therapeutic potential of human NPS receptor-directed signalingin vivo. PMID: 26865629
  7. anxiety sensitivity correlated negatively with prefrontal activity in NPSR1 rs324981 carriers possibly suggesting a decompensation of the adaptive compensatory upregulation PMID: 25971599
  8. Results suggest the functional NPSR1 gene A/T variant to influence glutamate+glutamine concentrations in the bilateral anterior cingulate cortex in healthy male subjects during CCK-4 induced panic PMID: 26235955
  9. The T-allele of the NPSR1 rs324981 polymorphism is associated with increased impulsivity and ADHD-related traits in non-clinical cohorts. PMID: 25744621
  10. The results suggest neuropeptide S receptor gene variation to be associated with alterations of prefrontal functioning in the attentional functions alerting and executive control partly modulated by anxiety sensitivity. PMID: 25842293
  11. Results show that NPSR1 polymorphism is associated with AUD and alcohol consumption, dependent on sex, environment and age. PMID: 24754478
  12. gene polymorphism is a risk factor for high IgE-associated atopic eczema at the age of two years in Finland if there is no probiotic treatment PMID: 24439655
  13. The functional SNP rs324981 located in the gene of NPSR1 was significantly associated with objectively obtained sleep parameters in a sample of elderly white subjects PMID: 24896296
  14. results suggest a potential protective function of the NPSR1 rs324981 A/A genotype against pathologically enhanced anxiety that might be explained by stronger reflective prefrontal regulation over the subcortical fear response. PMID: 23103692
  15. Genetic variation at the NPSR1 locus impacts children's predisposition to ecurrent abdominal pain episodes in a Swedish population. PMID: 25091462
  16. study provides first evidence for the assumption that a NPSR1 variant modulates brain activation under stress, interacting with the environmental risk factor urban upbringing PMID: 24800784
  17. In the Estonian population, NPSR1 A/T polymorphism together with environmental factors is associated with anxious, depressive and activity-related traits, increased prevalence of affective/anxiety disorders and a higher likelihood of suicidal behaviour. PMID: 24331455
  18. NPSR1 A/T polymorphism is associated with impulsivity, ADHD symptoms and personality, mirroring the activity- and anxiety-mediating role of NPSR1. PMID: 23325374
  19. Neuropeptide S receptor 1 (NPSR1) activates cancer-related pathways and is widely expressed in neuroendocrine tumors. PMID: 24915894
  20. Differential gene-environment effects of the NPSR rs324981 T allele indicate recent life events with respect to anxiety sensitivity. PMID: 22404660
  21. NPS receptor may have a pathological role in individuals with severe asthma and/or elevated serum IgE levels. PMID: 24239856
  22. The present data demonstrated that QA1 and PI1 act as potent NPSR antagonists in vitro, however their usefulness for in vivo investigations in mice seems limited probably by pharmacokinetic reasons. PMID: 23911665
  23. Relate NPSR1 genotype to early onset obsessive-compulsive disorder. PMID: 23680103
  24. The results of this study showed involvement of the NPS system in the regulation of the neuroendocrine stress response in humans. PMID: 23466585
  25. RORA SNPs are associated with childhood asthma and show epistasis with NPSR1, and the interaction between RORA and NPSR1 may be of biological relevance. PMID: 23565190
  26. In summary, the more active NPSR1 T allele may confer enhanced response inhibition and increased error monitoring and might drive particularly error monitoring as a neurophysiological endophenotype of anxiety PMID: 23319044
  27. NPS is able to stimulate human monocyte chemotaxis and that this effect is entirely due to selective NPSR activation. PMID: 23142110
  28. DNA methylation levels in the promoter of NPSR1 showed small but significant associations with asthma and to related traits such as allergy and certain environmental exposures. PMID: 23372674
  29. we consider NPSR as a promising target for antipsychotic drug development PMID: 22078257
  30. analysis of molecular evolution of the neuropeptide S receptor and cross-species comparison PMID: 22479518
  31. NPSR1 gene is associated with reduced risk of rheumatoid arthritis. PMID: 22548958
  32. findings represent a first step to decipher NPSR1 locus complexity and its impact on several human conditions NPS antagonists have been recently described, and our results are of potential pharmacogenetic relevance PMID: 22216302
  33. Ther neuropeptide S receptor genotype is associated with increased amygdala responsiveness to fear-relevant stimuli. PMID: 21525857
  34. results provide converging evidence for a female-dominant role of NPSR gene variation in panic disorder through heightened autonomic arousal and distorted processing of anxiety-relevant emotional stimuli. PMID: 20603625
  35. There is an NPSR1 isoform-specific link to pathogenetic processes in asthma and allergy. PMID: 21707994
  36. data suggest a genetic and neuroanatomical substrate for catastrophizing overinterpretations of fear reactions. PMID: 20628342
  37. The available information regarding NPS and its receptor and the biological actions modulated by the NPS-NPSR system, is summarized. PMID: 19824051
  38. NPS-NPSR1 signaling is likely involved in anxiety PMID: 20705147
  39. Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20701904
  40. Data show that NPSR1 polymorphism may be relevant to RA susceptibility and its clinical manifestation. PMID: 20179762
  41. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  42. Observational study of gene-disease association. (HuGE Navigator) PMID: 20603625
  43. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
  44. Observational study of gene-disease association. (HuGE Navigator) PMID: 20628342
  45. Observational study of gene-disease association. (HuGE Navigator) PMID: 20705147
  46. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  47. Observational study of gene-disease association. (HuGE Navigator) PMID: 20503287
  48. Results suggest that N-linked glycosylation is not important for neuropeptide S receptor biogenesis or function, and that residue D105 might be critical for receptor binding. PMID: 19874863
  49. Observational study of gene-disease association. (HuGE Navigator) PMID: 20179762
  50. Expression of several neuropeptides is induced upon NPS-NPSR1 signaling; NPSR1 variants are associated with colonic transit in functional gastrointestinal diseases PMID: 19732772

Show More

Hide All

Involvement in disease
Asthma-related traits 2 (ASRT2)
Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 3]: Cell membrane; Multi-pass membrane protein.; [Isoform 4]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cytoplasm.; [Isoform 5]: Cytoplasm.; [Isoform 6]: Cytoplasm.; [Isoform 7]: Cytoplasm.; [Isoform 9]: Cytoplasm.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Tissue Specificity
Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in the smooth muscle ce
Database Links

HGNC: 23631

OMIM: 608584

KEGG: hsa:387129

STRING: 9606.ENSP00000352839

UniGene: Hs.652373

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1