Recombinant Human Ninjurin-2 (NINJ2)

Code CSB-CF885775HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
NINJ2
Uniprot No.
Alternative Names
NINJ2; Ninjurin-2; Nerve injury-induced protein 2
Species
Homo sapiens (Human)
Expression Region
1-142
Target Protein Sequence
MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV FITAFGAHKTGFLAARASRNPL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Homophilic cell adhesion molecule that promotes axonal growth. May play a role in nerve regeneration and in the formation and function of other tissues.
Gene References into Functions
  1. our study suggests that ninjurin2 is a novel regulator of endothelia inflammation and activation through TLR4 signaling pathways, and these data provided new insights into the mechanisms between NINJ2 and atherosclerosis. PMID: 28431986
  2. the AA genotype carriers had significantly increased NINJ2 mRNA expression levels in the Chinese population, suggesting that the rs3809263 G > A polymorphism is a functional single nucleotide polymorphism and a biomarker for risk of large artery atherosclerotic stroke. PMID: 26687183
  3. Data shows that common and rare variants in the NINJ2 region were nominally associated with incident ischemic stroke patients. PMID: 24959832
  4. Risk of ischemic stroke was higher especially when the carriers of rs11833579 AA NINJ2 genotype were smokers. PMID: 24664524
  5. Data suggest that the gene NINJ2 rs11833579 A/A or G/A genotype may bring forward the onset age of first-ever ischemic stroke without increasing silent cerebrovascular lesions prior to the stroke. PMID: 22429733
  6. This meta-analysis suggest that rs12425791 is relative to ischemic stroke risk under dominant model in Asian population, but not for rs11833579. PMID: 22795341
  7. In this meta-analysis, NINJ2 single-nucleotide polymorphism (SNP) rs12425791 is significantly associated with ischemic stroke in an East Asian (but not Chinese Han) population, of which A alleles increase the risk of ischemic stroke. PMID: 22297388
  8. A new genetic variant rs10849373 located in the first intron of the NINJ2 gene confers risk of ischemic stroke in Chinese Han subjects. PMID: 21722921
  9. 12p13 SNPs rs11833579 and rs12425791 within NINJ2 gene do not seem to be associated with ischemic stroke in Chinese Han population PMID: 21376321
  10. polymorphisms of the vascular susceptibility gene NINJ2 were associated with risk of Alzheimer's disease PMID: 21674003
  11. There is a significant association between rs11833579 site polymorphism of the NINJ2 gene and risk for stroke in Han Chinese. PMID: 20957003

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Ninjurin family
Tissue Specificity
Widely expressed. In adult, higher expression in the bone marrow and peripheral blood lymphocytes, medium in the lung, lymph node, thyroid, uterus, thymus, spleen, prostate and skeletal muscle, lower in the liver, placenta, brain, heart and kidney. In emb
Database Links

HGNC: 7825

OMIM: 607297

KEGG: hsa:4815

STRING: 9606.ENSP00000307552

UniGene: Hs.655804

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1