Recombinant Human Olfactory receptor 13C3(OR13C3)

Code CSB-CF850900HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8NGS6
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MIVQLICTVCFLAVNTFHVRSSFDFLKADDMGEINQTLVSEFLLLGLSGYPKIEIVYFAL ILVMYLVILIGNGVLIIASIFDSHFHTPMYFFLGNLSFLDICYTSSSVPSTLVSLISKKR NISFSGCAVQMFFGFAMGSTECLLLGMMAFDRYVAICNPLRYPIILSKVAYVLMASVSWL SGGINSAVQTLLAMRLPFCGNNIINHFACEILAVLKLACADISLNIITMVISNMAFLVLP LMVIFFSYMFILYTILQMNSATGRRKAFSTCSAHLTVVIIFYGTIFFMYAKPKSQDLIGE EKLQALDKLISLFYGVVTPMLNPILYSLRNKDVKAAVKYLLNKKPIH
Source in vitro E.coli expression system
Gene Names OR13C3
Protein Names Recommended name: Olfactory receptor 13C3 Alternative name(s): Olfactory receptor OR9-8
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 14704

KEGG: hsa:138803

STRING: 9606.ENSP00000363913

UniGene: Hs.553600

Related Products

OR13C3 Antibodies

OR13C3 Antibodies for Homo sapiens (Human)

OR13C3 Proteins

OR13C3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.