Recombinant Human Olfactory receptor 5B3(OR5B3)

Code CSB-CF847739HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8NH48
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MENKTEVTQFILLGLTNDSELQVPLFITFPFIYIITLVGNLGIIVLIFWDSCLHNPMYFF LSNLSLVDFCYSSAVTPIVMAGFLIEDKVISYNACAAQMYIFVAFATVENYLLASMAYDR YAAVCKPLHYTTTMTTTVCARLAIGSYLCGFLNASIHTGDTFSLSFCKSNEVHHFFCDIP AVMVLSCSDRHISELVLIYVVSFNIFIALLVILISYTFIFITILKMHSASVYQKPLSTCA SHFIAVGIFYGTIIFMYLQPSSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFK KVVEKAKLSVGWSV
Source in vitro E.coli expression system
Gene Names OR5B3
Protein Names Recommended name: Olfactory receptor 5B3 Alternative name(s): Olfactory receptor 5B13 Olfactory receptor OR11-239
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 8324

KEGG: hsa:441608

STRING: 9606.ENSP00000308270

UniGene: Hs.553826

Related Products

OR5B3 Antibodies

OR5B3 Antibodies for Homo sapiens (Human)

OR5B3 Proteins

OR5B3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.