Recombinant Human P2Y purinoceptor 11 (P2RY11)

Code CSB-CF846624HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
P2RY11; P2Y purinoceptor 11; P2Y11
Species
Homo sapiens (Human)
Expression Region
1-374
Target Protein Sequence
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA APKPSEPQSRELSQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP.
Gene References into Functions
  1. these results show hepatocellular carcinoma-specific expression of the P2Y11 receptor and its critical role in mediating ATP-inducing Ca2+ signalling and regulating cancer cell migration PMID: 28418839
  2. Decreased P2Y11 signaling plays an important role in the development of narcolepsy with cataplexy. PMID: 28460015
  3. Hypoxia/reoxygenation inhibits P2y11 receptor expression and its immunosuppressive activity in human dendritic cells. PMID: 26078273
  4. Suggest role for LXA4 in stimulating apical ATP secretion via pannexin-1 channels and P2RY11 purinoreceptors activation leading to an airway surface liquid layer height increase and epithelial repair. PMID: 24588705
  5. vesicular exocytosis of ATP and autocrine, positive feedback through P2Y11 receptors is required for the effective activation of macrophages PMID: 23577075
  6. P2Y11 receptor mediates interferon gamma-induced IL-6 production in HaCaT cells, suggesting the importance of purinergic signaling in interferon-gamma induced skin inflammatory conditions PMID: 23461851
  7. P2Y11 receptors are abundantly and diffusely expressed intracellularly in skeletal muscle fibers. PMID: 22052557
  8. The study extends on the observation of a strong multiethnic association of polymorphisms in the TCRA and P2RY11 with narcolepsy, but does not confirm the association of CPT1B/CHKB (rs5770917) in the Chinese population. PMID: 22177342
  9. Extracellular NAD stimulates mesenchymal stem cell functions through activation of P2Y11 receptor. PMID: 20964598
  10. Common variants in P2RY11 are associated with narcolepsy. PMID: 21170044
  11. Inhibition of Natural killer cell response to CX3CL1 is mediated by the P2Y11 receptor. PMID: 20668227
  12. beta-NAD(e)+ is an agonist of the P2Y(11) purinoceptor and P2Y(11) is the endogenous receptor in granulocytes mediating the sustained [Ca2+]i increase responsible for their functional activatio PMID: 16926152
  13. We propose that residues Arg106, Arg268, Arg307 and Glu186 are involved in ionic interactions with the phosphate moiety of ATP. Arg307 is possibly also H-bonded to N6 of ATP via the backbone carbonyl. PMID: 17338680
  14. In human granulocytes, endogenous P2Y(11) proved to be responsible for NAADP+-induced cell activation, unveiling a role of NAADP+ as a pro-inflammatory cytokine. PMID: 17707504
  15. The P2 receptor mediating the antiapoptotic actions of ATP was identified using a combination of more selective ATP analogs, receptor expression studies, and study of downstream signaling pathways. PMID: 18056402
  16. present data clearly show that P2Y purinoceptor 11 and P2Y purinoceptor 12 are expressed in human pancreatic islets PMID: 18726826

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highest expression in liver and spleen.
Database Links

HGNC: 8540

OMIM: 602697

KEGG: hsa:5032

STRING: 9606.ENSP00000323872

UniGene: Hs.14468

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1