Recombinant Human P2Y purinoceptor 2 (P2RY2)

Code CSB-CF017334HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
P2RY2; P2RU1; P2Y purinoceptor 2; P2Y2; ATP receptor; P2U purinoceptor 1; P2U1; P2U receptor 1; Purinergic receptor
Species
Homo sapiens (Human)
Expression Region
1-377
Target Protein Sequence
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR RTESTPAGSENTKDIRL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. The affinity range is UTP = ATP > ATP-gamma-S >> 2-methylthio-ATP = ADP.
Gene References into Functions
  1. Study demonstrated that the P2Y2 receptor was highly expressed in MCF7 and Hs578T breast cancer cells and indicated that the P2Y2 receptor promoted cell migration and invasion in breast cancer cells via EMT-related genes Snail and E-cadherin. PMID: 29115551
  2. Our results clearly demonstrate the involvement of P2Y2R subtypes in the pathogenesis of fibrotic lung diseases in humans and mice and hence support the development of selective P2Y2R antagonists for the treatment of IPF. PMID: 28415591
  3. Proliferation and migration of functionally impaired cardiac progenitor cells are enhanced by P2Y2R-mediated YAP activation, revealing a novel link between extracellular nucleotides released during injury/stress and Hippo signaling-a central regulator of cardiac regeneration. PMID: 28923792
  4. nterleukin-8 release after purinergic stimulation in ALI-cultured HEECs is mediated through P2Y2 receptor activation. PMID: 27977904
  5. Human umbilical vein endothelial cells exposed to either P2Y2 receptor antagonists or siRNA showed impaired fluid shear stress-induced cell alignment, and actin stress fiber formation as early as 6 h. PMID: 27652381
  6. There is increased expression of P2Y2 receptors in the rectosigmoid mucosa of diarrhea-predominant irritable bowel syndrome patients. P2Y2 correlated with abdominal pain. PMID: 27250983
  7. A novel SNP-systemic lupus erythematosus association was identified between FCHSD2 and P2RY2, peaking at rs11235667 on a 33-kb haplotype upstream of ATG16L2. PMID: 26663301
  8. Hypoxia and upregulated HIF-1a both upregulated the P2Y2 levels in hepatocellular carcinoma cells and increased their survival. PMID: 27807254
  9. Results show that purinergic receptor P2Y2 (P2Y2R) requires N-glycosylation for expression on the cell surface. PMID: 28209512
  10. Data indicate that knockdown of caveolin-1 (Cav-1) expression causes redistribution of the P2Y2 nucleotide receptor (P2Y2R) from membrane rafts. PMID: 27129210
  11. The P2RY2 receptor induces carcinoma cell migration and epithelial-mesenchymal transition through cross-talk with EGFR. PMID: 26443721
  12. Activation of P2Y2R increased TF promoter activity and mRNA expression in coronary artery endothelial cells. PMID: 26631725
  13. Data show that the purinergic receptor P2Y2 (P2Y2R) pepducin activates neutrophils through formyl peptide receptor 2 (FPR2), and ATP is turned into an activating agonist through a receptor cross-talk mechanism that involves both FPR2 and P2Y2R. PMID: 26996596
  14. P2Y2 receptor and EGFR cooperate to promote prostate cancer cell invasion via ERK1/2 pathway. PMID: 26182292
  15. These results indicate that B2R couples with P2Y2R and that these G-protein-coupled receptors act together to fine-tune cellular responsiveness. PMID: 25713410
  16. These results suggest that over-activated ERK and PKC pathways are involved in the P2Y2R-mediated invasion of breast cancer cells. PMID: 26063340
  17. P2Y2 and Gq/G11 are required for basal endothelial NO formation, vascular tone, and blood pressure. PMID: 26168216
  18. P2Y2R may play an important role in cancer metastasis via modulation of the crosstalk between cancer cells and endothelial cells. PMID: 25156554
  19. These results demonstrate that P2Y2R plays an important role in activation of the HIF-1alpha-LOX axis, the induction of collagen crosslinking and the recruitment of CD11b+ hematopoietic bone marrow-derived cells. PMID: 25238333
  20. ATP increased P2Y-mediated upregulation of MUC8 expression; however, IL-1alpha significantly decreased the extent to which ATP/P2Y upregulated MUC8 expression. PMID: 25575516
  21. Signaling cascades evoked by P2Y2 receptor plays an important role in the phenomena dependent on the actin cytoskeleton dynamics endocy-tosis, cell division, adhesion, intracellular transport and migration.(review) PMID: 25807824
  22. P2Y2 receptor fails to repress IL-6 expression by valve interstitial cells through Akt in calcific aortic valve disease. PMID: 24631773
  23. The genes CD248, Ephb1 and P2RY2 were detected as the top overexpressed in GC biopsies. PMID: 24716914
  24. siRNA against P2Y2R or RAGE, suggesting that P2Y2R is an important mediator in oxLDL-mediated monocyte adhesion to ECs through the regulation of ROS-dependent adhesion molecule expression in ECs. PMID: 24486339
  25. P2Y2 receptor deletion in transgenic mice increased Beta-amyloid plaque load and soluble AB1-42 levels in brain from Alzheimer's disease model animals. PMID: 24193664
  26. P2Y2R mediated the action of ATP on the cellular behavior of HCC cells through store-operated calcium channel-mediated Ca(2+) signaling PMID: 24847054
  27. reflected in the immunoblotting data P2RY2 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy. PMID: 25003238
  28. P2Y2 overexpression elevates the inhibitory effect of extracellular ATP on the proliferation of nasopharyngeal carcinoma cells. PMID: 24961145
  29. The activation of P2Y2 receptors increases MCF-7 breast cancer cells migration through the MEK-ERK1/2 signalling pathway. PMID: 24390819
  30. decrease in Src Y421 and Y446 and paxillin Y118 was detected, indicating the far-reaching importance of the P2Y2 receptor in mediating migration. PMID: 24095926
  31. signals generated by the receptor for ATP (P2Y2) reactivate desensitized formyl peptide receptors (FPRs) so that these ligand-bound inactive FPRs resume signaling. PMID: 24491917
  32. Results suggest that P2Y2 receptor desensitization protects airways against the deleterious effects of persistent fluid secretion. PMID: 23757023
  33. Uridine triphosphate increases proliferation of cancerous pancreatic duct epithelial cells by activation of P2Y2 receptor and PI3K/Akt pathway. PMID: 23462325
  34. suggest the P2Y2 receptor and its endothelial downstream signaling mechanisms as a target for antimetastatic therapies PMID: 23810565
  35. In women, bone mineral density values at all sites were significantly different between the genotypes for the Leu46Pro polymorphism of the p2y2 receptor PMID: 22773251
  36. Activation of P2Y2R and Galphaq by uridine triphosphate promotes hemidesmosome formation. PMID: 22718344
  37. IL-8 and IL-6 release after purinergic stimulation in uroepithelial cells is mediated through P2V2 receptors activation. PMID: 23088987
  38. Data define the expression profile of P2Y receptors on human biliary epithelial cancer cells and indicate P2Y2 receptors as being potential targets in new treatment strategies for biliary cancer. PMID: 22993317
  39. Upon activation by ursolic acid , P2Y2 activated Src which in turn phosphorylated p38 leading to COX-2 overexpression which induced resistance to apoptosis in both colorectal and prostate cancer cells PMID: 22521508
  40. Adenosine triphosphate (ATP) enhances proliferation, adhesion, and migration via P2Y2R activation and the immunosuppressive ability of regulatory T (Treg) cells. PMID: 22753942
  41. estrogen, via estrogen alpha receptors, promotes proliferation of breast cancer cells by down-regulating purinergic receptor P2Y receptor expression thereby attenuating calcium signaling PMID: 21356271
  42. Inhibition of any of the constituents of this cascade (pannexin-1, ATP, P2Y2, and Pyk2) impairs the replication of HIV-1 mutant viruses that are resistant to conventional antiretroviral agents. PMID: 21859844
  43. P2Y(2) receptor mediates TF expression in HCAEC through new mechanisms involving Src/p38 and Rho/JNK pathways, possibly contributing to a pro-thrombotic status after vascular injury. PMID: 21652710
  44. A P2Y2 isoform represents the predominant purinergic receptor underlying ATP-evoked Ca2+ mobilization, membrane hyperpolarization and de novo synthesis of nitric oxide. PMID: 21414662
  45. P2Y(2) R appears to be involved in asthmatic airway inflammation PMID: 20880147
  46. Purinergic receptors might represent important new set of molecular targets for theca hyperplasia and polycystic ovarian syndrome. PMID: 20630102
  47. Data report that activation of P2Y(2) receptors by extracellular UTP inhibits the IGF-I-induced p110alpha-PI3K activation. PMID: 20089844
  48. P2Y2 is the key player in the response of corneal epithelial cells to cell damage and subsequent repair events. PMID: 20427708
  49. The rs4944831 and the T-A-G haplotype of the human P2RY2 gene might be genetic markers for essential hypertension in Japanese men. PMID: 19710694
  50. These results suggest that P2Y(2)R activation in salivary gland cells promotes the formation of EGFR/ErbB3 heterodimers and metalloprotease-dependent neuregulin 1 release, resulting in the activation of both EGFR and ErbB3. PMID: 20064929

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Spleen, testis, kidney, liver, lung, heart and brain.
Database Links

HGNC: 8541

OMIM: 600041

KEGG: hsa:5029

STRING: 9606.ENSP00000310305

UniGene: Hs.339

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1