Recombinant Human PRA1 family protein 3 (ARL6IP5)

Code CSB-CF002096HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ARL6IP5
Uniprot No.
Alternative Names
ARL6IP5; DERP11; JWA; PRA2; PRAF3; HSPC127; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5; Cytoskeleton-related vitamin A-responsive protein; Dermal papilla-derived protein 11; GTRAP3-18; Glutamate transporter EAAC1-interacting protein; JM5; Prenylated Rab acceptor protein 2; Protein JWa; Putative MAPK-activating protein PM27
Species
Homo sapiens (Human)
Expression Region
1-188
Target Protein Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. Plays a role in the retention of SLC1A1/EAAC1 in the endoplasmic reticulum.
Gene References into Functions
  1. These data demonstrated that JWA suppressed the migration/invasion of breast carcinoma cells by downregulating the expression of CXCR4, and suggested that JWA may harbor prognostic and therapeutic potential in patients with breast cancer. PMID: 29658570
  2. increased RNF185 expression facilitated GC cell migration in vitro and promoted GC metastasis in vivo by downregulating JWA expression. PMID: 29481911
  3. our results demonstrate that JWA is a novel negative regulator of HER2 expression...in HER2-positive gastric cancer cells PMID: 27167206
  4. Protective effect of JWA against paraquat neurotoxicity involves regulation of the MEK/PI3K-Nrf2 axis. PMID: 28428137
  5. JWA and topoisomerase II alpha regulate each other in tumor cells arrested in G2/M. PMID: 26046674
  6. the JWA gene may regulate human breast cancer cells through the MAPK signaling pathway using different types of regulation. PMID: 25586271
  7. This review gives an overview of EAAC1-mediated GSH synthesis, and its regulatory mechanisms by GTRAP3-18 in the brain, and a potential approach against neurodegeneration. PMID: 23109897
  8. JWA reverses cisplatin resistance via the CK2-XRCC1 pathway in human gastric cancer cells. PMID: 25476899
  9. data demonstrate that JWA plays a crucial role in HCC progression and suggest JWA may be a potential prognostic biomarker and therapeutic target for HCC. PMID: 23169062
  10. A significant negative correlation between JWA and ILK in melanoma biopsies. PMID: 24064223
  11. Loss of JWA expression was strongly correlated with increased gastric cancer angiogenesis. PMID: 24072772
  12. JWA has an important role in ING4-regulated melanoma angiogenesis, and ING4/JWA/ILK are promising prognostic markers and may be used as anti-angiogenic therapeutic targets for melanoma. PMID: 24157826
  13. A combined effect of p53 with JWA as efficient prognostic indicators was found for the first time. PMID: 23285001
  14. JWA plays an important role in the occurrence and progress of human esophageal squamous cell carcinoma (ESCC) and that high expression level of JWA may predict a favorable prognosis in ESCC patients. PMID: 23461062
  15. JWA and XRCC1 protein levels were downregulated in gastric cancer lesions compared with adjacent noncancerous tissues;JWA and XRCC1 protein expressions in tumor are candidate prognostic markers and predictive factors for benefit from adjuvant platinum-based chemotherapy in resectable gastric carcinoma PMID: 22452940
  16. The gene polymorphisms at site 76 and GG/CT haploid type of JWA gene were associated with hypertension in workers exposed to high temperature. PMID: 22357531
  17. PRAF3 plays an important role in the regulation of tumor progression and metastasis and serves as a tumor suppressor in human ESCC. We propose that PRAF3 might be used as a potential therapeutic agent for human ESCC. PMID: 22433565
  18. JWA night play an important role in neoplastic transformation of HBE cells through regulation of p53 expression. PMID: 19080375
  19. all-trans retinoic acid increased JWA gene expression in human pulmonary artery smooth muscle cells. PMID: 16638297
  20. Rsults suggest that JWA can be regulated by oxidative stress and is actively involved in the signal pathways of oxidative stress in the cells. PMID: 15864752
  21. Data show that the JWA -76G-->C variant genotype may play an important role in transcription regulation of JWA gene and in the susceptibility to bladder cancer. PMID: 16331563
  22. JWA may function as a lineage-restricted gene during differentiation along the monocyte/macrophage-like or granulocytic pathway PMID: 16430862
  23. all-trans retinoic acid up-regulates JWA expression by stimulating the transcriptional activity of JWA gene promoter PMID: 16468075
  24. The JWA determined might function as a potential effective environmental responsive gene and actively participated in the process of B (a) P exposure associated with intracellular signal pathways of DNA damage and repair PMID: 16640902
  25. JWA participates in the signal pathways of H2O2 induced oxidative stress in K562 cells PMID: 16766476
  26. The effects of All Trans Retinoic Acid in regulating cellular proliferation and apoptosis may be mediated in part by JWA expression. PMID: 16922813
  27. JWA regulated-tumor cellular migration might involve MAPK cascades activation and F-actin cytoskeleton rearrangement mechanisms. PMID: 17336041
  28. Three novel functional genetic poly- morphisms of JWA gene, -76C, 454A, and 723G, appear to contribute to the etiology of bladder cancer PMID: 17479401
  29. Single nucleotide polymorphisms of JWA were associated with enhanced risk of gastric cancer and esophageal squamous cell carcinoma in a Chinese population. PMID: 17479402
  30. The potentially functional genetic polymorphism 454CA of the JWA gene appears to contribute to the risk of multiple kinds of leukemia in a south Chinese population. PMID: 17479403
  31. These results show GTRAP3-18 to negatively and dominantly regulate cellular GSH content via interaction with EAAC1 at the plasma membrane. PMID: 17646425
  32. Expression of GTRAP3-18 delays the ER exit of EAAC1, as well as other members of the excitatory amino acid transporter family. PMID: 18167356
  33. This paper deals primarily with PRAF2, but comparisons with PRAF3 are also provided. PMID: 16481131
  34. protein expression is upregulated by methyl-beta-cyclodextrin and not by retinoic acid PMID: 12562531
  35. highly conserved protein and genomic organization amongst vertebrates PMID: 12119102

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.
Protein Families
PRA1 family
Database Links

HGNC: 16937

OMIM: 605709

KEGG: hsa:10550

STRING: 9606.ENSP00000273258

UniGene: Hs.518060

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1