Recombinant Human Parathyroid hormone 2 receptor(PTH2R)

Code CSB-CF018990HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P49190
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPC PPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY
Source in vitro E.coli expression system
Gene Names PTH2R
Protein Names Recommended name: Parathyroid hormone 2 receptor Short name= PTH2 receptor
Expression Region 27-145
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity Expressed abundantly in brain and pancreas. Also expressed in the testis.
Database Links

HGNC: 9609

OMIM: 601469

KEGG: hsa:5746

STRING: 9606.ENSP00000272847

UniGene: Hs.570296

Related Products

PTH2R Antibodies

PTH2R Antibodies for Homo sapiens (Human)

PTH2R Proteins

PTH2R Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.