Recombinant Human Pituitary tumor-transforming gene 1 protein-interacting protein (PTTG1IP)

Code CSB-CF019075HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PTTG1IP
Uniprot No.
Alternative Names
PTTG1IP; C21orf1; C21orf3; Pituitary tumor-transforming gene 1 protein-interacting protein; Pituitary tumor-transforming gene protein-binding factor; PBF; PTTG-binding factor
Species
Homo sapiens (Human)
Expression Region
33-180
Target Protein Sequence
QEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May facilitate PTTG1 nuclear translocation.
Gene References into Functions
  1. Nnegative pituitary tumor-transforming gene 1 protein-interacting protein (PTTG1IP) immunoexpression predicted a 1.5-fold risk of breast cancer death. PMID: 29078751
  2. data reveal new insight into PBF function and confirm that, rather than being oncogenic, mutations in PBF are likely to be passenger effects, with overexpression of PBF the more important etiological event in human cancer PMID: 28676500
  3. PTTG1IP and MAML3 are associated with BHR severity in adult asthma. The relevance of these genes is supported by the eQTL analyses and co-expression of PTTG1lP with vimentin and E-cadherin1, and MAML3 with MAML2. PMID: 27709636
  4. Findings indicate that PBF and PTTG have a critical role in promoting thyroid cancer that is predictive of poorer patient outcome. PMID: 28504713
  5. Unique role for PBF in regulating CTTN function to promote endocrine cell invasion and migration. PMID: 27603901
  6. these results demonstrate an emerging role for PBF in colorectal tumorigenesis through regulating p53 activity, with implications for PBF as a prognostic indicator for invasive tumors. PMID: 25408419
  7. These findings indicate that miR-584 suppresses glioma cell growth by negatively regulating the expression of PTTG1IP, suggesting that miR-584 has a tumor suppressive role in human glioma pathogenesis. PMID: 25674221
  8. protooncogene PBF is a negative regulator of p53 function in thyroid tumorigenesis, in which PBF is generally overexpressed and p53 mutations are rare compared with other tumor types PMID: 24506068
  9. Data from mutant recombinant proteins suggest that proto-oncogene PBF is a phosphoprotein and highlight importance of tyrosine residue Y174 in both endocytosis of PBF and its interaction/co-localization with NIS/SLC5A5 (sodium-iodide symporter). PMID: 23678037
  10. PBF expression may be a promising biomarker for prognostic and therapeutic purposes in papillary thyroid carcinoma patients. PMID: 22888961
  11. Authors identified pituitary tumor-transforming gene 1 (PTTG1) binding factor (PBF) as a target of miR-122 and demonstrated that hepatitis B virus replication causes an obvious increase in PBF levels. PMID: 23221562
  12. The present study provides the first epidemiological evidence that functional regulatory variants of PTTG1IP were associated with the risk of ER-positive breast cancer, further supporting its relevance as one proto-oncogene in breast cancer. PMID: 22404099
  13. overexpression of PBF causes thyroid cell proliferation, macrofollicular lesions, and hyperplasia, as well as repression of the critical therapeutic route for radioiodide uptake PMID: 21844185
  14. PBF's role in endocrine cancer is discussed. [review] PMID: 21129230
  15. PTTG expression was higher in malignant cells than in primary astrocytes, whereas PTTG-binding factor was not in astrocytoma PMID: 15178645
  16. overexpression of PTTG and PBF in differentiated thyroid cancer has profound implications for activity of the NIS gene, and hence significantly impacts upon the efficacy of radioiodine treatment. PMID: 17297475

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Cytoplasm. Nucleus. Note=According to PubMed:10781616, it is found in the cytoplasm and the nucleus.
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 13524

OMIM: 603784

KEGG: hsa:754

STRING: 9606.ENSP00000328325

UniGene: Hs.474010

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×