Recombinant Human Platelet-activating factor receptor(PTAFR)

Code CSB-CF018946HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25105
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Source in vitro E.coli expression system
Gene Names PTAFR
Protein Names Recommended name: Platelet-activating factor receptor Short name= PAF-R Short name= PAFr
Expression Region 1-342
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in the placenta, lung, left and right heart ventricles, heart atrium, leukocytes and differentiated HL-60 granulocytes.
Database Links

HGNC: 9582

OMIM: 173393

KEGG: hsa:5724

STRING: 9606.ENSP00000301974

UniGene: Hs.77542

Pathway Calcium signaling pathway

Related Products

PTAFR Antibodies

PTAFR Antibodies for Homo sapiens (Human)

PTAFR Antibodies for Human

PTAFR Proteins

PTAFR Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.