Recombinant Human Polycystic kidney disease 2-like 2 protein(PKD2L2)

Code CSB-CF882158HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NZM6
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKV MSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIY YENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYST SNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNA NVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQE VKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYF LACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFA YAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFF VLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTK GSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYA VELEKELHYINLKLNQVVRKVSAL
Source in vitro E.coli expression system
Gene Names PKD2L2
Protein Names Recommended name: Polycystic kidney disease 2-like 2 protein Alternative name(s): Polycystin-2L2 Polycystin-L2
Expression Region 1-624
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function as a subunit of a cation channel and play a role in fertilization.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Polycystin family
Tissue Specificity According to PubMed:10602361, expressed only in testis. According to PubMed:10756092, expressed also in brain and kidney. Isoform 2 is found only in transformed lymphoblasts. Isoform 3 is found in all tissues tested.
Database Links

HGNC: 9012

OMIM: 604669

KEGG: hsa:27039

STRING: 9606.ENSP00000290431

UniGene: Hs.716884

Related Products

PKD2L2 Antibodies

PKD2L2 Antibodies for Human

PKD2L2 Proteins

PKD2L2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.