Recombinant Human Potassium channel subfamily K member 16(KCNK16)

Code CSB-CF850434HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96T55
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF PISKKGLGS
Source in vitro E.coli expression system
Gene Names KCNK16
Protein Names Recommended name: Potassium channel subfamily K member 16 Alternative name(s): 2P domain potassium channel Talk-1 TWIK-related alkaline pH-activated K(+) channel 1 Short name= TALK-1
Expression Region 1-309
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Highly expressed in pancreas. Not detectable in the other tissues tested.
Database Links

HGNC: 14464

OMIM: 607369

KEGG: hsa:83795

STRING: 9606.ENSP00000391498

UniGene: Hs.287765

Related Products

KCNK16 Antibodies

KCNK16 Antibodies for Human

KCNK16 Proteins

KCNK16 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.