Recombinant Human Potassium channel subfamily K member 17(KCNK17)

Code CSB-CF836305HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96T54
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYG NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLA GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW YKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Source in vitro E.coli expression system
Gene Names KCNK17
Protein Names Recommended name: Potassium channel subfamily K member 17 Alternative name(s): 2P domain potassium channel Talk-2 Acid-sensitive potassium channel protein TASK-4 TWIK-related acid-sensitive K(+) channel 4 TWIK-related alkaline pH-activ
Expression Region 1-332
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Database Links

HGNC: 14465

OMIM: 607370

KEGG: hsa:89822

STRING: 9606.ENSP00000362328

UniGene: Hs.162282

Related Products

KCNK17 Antibodies

KCNK17 Antibodies for Homo sapiens (Human)

KCNK17 Proteins

KCNK17 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.