Recombinant Human Potassium channel subfamily K member 4(KCNK4)

Code CSB-CF873692HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NYG8
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGL LIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFC IFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC LLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWIL LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKE QPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCP LPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV
Source in vitro E.coli expression system
Gene Names KCNK4
Protein Names Recommended name: Potassium channel subfamily K member 4 Alternative name(s): TWIK-related arachidonic acid-stimulated potassium channel protein Short name= TRAAK Two pore potassium channel KT4.1 Short name= Two pore K(+) channel
Expression Region 1-393
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Voltage-insensitive potassium channel
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Database Links

HGNC: 6279

OMIM: 605720

KEGG: hsa:50801

STRING: 9606.ENSP00000378033

UniGene: Hs.647233

Related Products

KCNK4 Antibodies

KCNK4 Antibodies for Homo sapiens (Human)

KCNK4 Proteins

KCNK4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.