Recombinant Human Potassium channel subfamily K member 7(KCNK7)

Code CSB-CF896880HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9Y2U2
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGGLRPWSRYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPP GALEELLGTALATQAHGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKA FCMVYAALGLPASLALVATLRHCLLPVLSRPRAWVAVHWQLSPARAALLQAVALGLLVAS SFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIYHLGQLALLG YLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQGGILGQDELALSTLPPAAPA SGQAPAC
Source in vitro E.coli expression system
Gene Names KCNK7
Protein Names Recommended name: Potassium channel subfamily K member 7
Expression Region 1-307
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable potassium channel subunit. No channel activity observed in vitro as protein remains in the endoplasmic reticulum. May need to associate with an as yet unknown partner in order to reach the plasma membrane.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Database Links

HGNC: 6282

OMIM: 603940

KEGG: hsa:10089

STRING: 9606.ENSP00000344820

UniGene: Hs.175218

Related Products

KCNK7 Antibodies

KCNK7 Antibodies for Homo sapiens (Human)

KCNK7 Proteins

KCNK7 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.