Recombinant Human Probable G-protein coupled receptor 148(GPR148)

Code CSB-CF823466HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8TDV2
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLA AATLAVSPLLLVTILRNQRLRQEPHYLLPANILLSDLAYILLHMLISSSSLGGWELGRMA CGILTDAVFAACTSTILSFTAIVLHTYLAVIHPLRYLSFMSHGAAWKAVALIWLVACCFP TFLIWLSKWQDAQLEEQGASYILPPSMGTQPGCGLLVIVTYTSILCVLFLCTALIANCFW RIYAEAKTSGIWGQGYSRARGTLLIHSVLITLYVSTGVVFSLDMVLTRYHHIDSGTHTWL LAANSEVLMMLPRAMLTYLYLLRYRQLLGMVRGHLPSRRHQAIFTIS
Source in vitro E.coli expression system
Gene Names GPR148
Protein Names Recommended name: Probable G-protein coupled receptor 148 Alternative name(s): Brain and testis restricted GPCR G-protein coupled receptor PGR6
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expression restricted to nervous system and testis. Is also detected in several tumors types, most notably prostate cancer.
Database Links

HGNC: 23623

KEGG: hsa:344561

STRING: 9606.ENSP00000308908

UniGene: Hs.452574

Related Products

GPR148 Proteins

GPR148 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.