Recombinant Human Probable G-protein coupled receptor 173(GPR173)

Code CSB-CF882095HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NS66
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MANTTGEPEEVSGALSPPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYF LLDLCLADGIRSAVCFPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHAAFMLFCISVT RYMAIAHHRFYAKRMTLWTCAAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRY FKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNWTFHGPGATGQ AAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWS PYIVACYWRVFVKACAVPHRYLATAVWMSFAQAAVNPIVCFLLNKDLKKCLRTHAPCWGT GGAPAPREPYCVM
Source in vitro E.coli expression system
Gene Names GPR173
Protein Names Recommended name: Probable G-protein coupled receptor 173 Alternative name(s): Super conserved receptor expressed in brain 3
Expression Region 1-373
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed at high levels in brain and ovary. Lower levels in small intestine. In brain regions, detected in all regions tested. Highest levels in the cerebellum and cerebral cortex.
Database Links

HGNC: 18186

OMIM: 300253

KEGG: hsa:54328

STRING: 9606.ENSP00000331600

UniGene: Hs.193011

Related Products

GPR173 Antibodies

GPR173 Antibodies for Homo sapiens (Human)

GPR173 Antibodies for Human

GPR173 Proteins

GPR173 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.