Recombinant Human Probable G-protein coupled receptor 174(GPR174)

Code CSB-CF887146HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9BXC1
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMIN LAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFL MYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLA QSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFL ICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFR RRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC
Source in vitro E.coli expression system
Gene Names GPR174
Protein Names Recommended name: Probable G-protein coupled receptor 174
Expression Region 1-333
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative receptor for purines coupled to G-proteins.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 30245

OMIM: 300903

KEGG: hsa:84636

UniGene: Hs.326713

Related Products

GPR174 Antibodies

GPR174 Antibodies for Homo sapiens (Human)

GPR174 Antibodies for Human

GPR174 Proteins

GPR174 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.