Recombinant Human Probable G-protein coupled receptor 21(GPR21)

Code CSB-CF860348HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99679
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MNSTLDGNQSSHPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLN HHTTSYFIQTMAYADLFVGVSCVVPSLSLLHHPLPVEESLTCQIFGFVVSVLKSVSMASL ACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQW CAESWHTDSYFTLFIVMMLYAPAALIVCFTYFNIFRICQQHTKDISERQARFSSQSGETG EVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGHSNRFASFLTTWLAISNSFCN CVIYSLSNSVFQRGLKRLSGAMCTSCASQTTANDPYTVRSKGPLNGCHI
Source in vitro E.coli expression system
Gene Names GPR21
Protein Names Recommended name: Probable G-protein coupled receptor 21
Expression Region 1-349
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus, hippocampus.
Database Links

HGNC: 4476

OMIM: 601909

KEGG: hsa:2844

STRING: 9606.ENSP00000362746

UniGene: Hs.722039

Related Products

GPR21 Antibodies

GPR21 Antibodies for Human

GPR21 Proteins

GPR21 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.