Recombinant Human Probable G-protein coupled receptor 62(GPR62)

Code CSB-CF874856HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9BZJ7
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MANSTGLNASEVAGSLGLILAAVVEVGALLGNGALLVVVLRTPGLRDALYLAHLCVVDLL AAASIMPLGLLAAPPPGLGRVRLGPAPCRAARFLSAALLPACTLGVAALGLARYRLIVHP LRPGSRPPPVLVLTAVWAAAGLLGALSLLGTPPAPPPAPARCSVLAGGLGPFRPLWALLA FALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAA LAPALAVGQFAACWLPYGCACLAPAARAAEAEAAVTWVAYSAFAAHPFLYGLLQRPVRLA LGRLSRRALPGPVRACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQ GPPESSLS
Source in vitro E.coli expression system
Gene Names GPR62
Protein Names Recommended name: Probable G-protein coupled receptor 62 Alternative name(s): G-protein coupled receptor GPCR8 Short name= hGPCR8 G-protein coupled receptor KPG_005
Expression Region 1-368
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in brain; detected in the basal forebrain, frontal cortex, caudate, putamen, thalamus and hippocampus.
Database Links

HGNC: 13301

OMIM: 606917

KEGG: hsa:118442

STRING: 9606.ENSP00000319250

UniGene: Hs.232213

Related Products

GPR62 Antibodies

GPR62 Antibodies for Homo sapiens (Human)

GPR62 Proteins

GPR62 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.