Recombinant Human Probable palmitoyltransferase ZDHHC8 (ZDHHC8)

Code CSB-CF890747HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ZDHHC8; KIAA1292; ZDHHCL1; ZNF378; Palmitoyltransferase ZDHHC8; Zinc finger DHHC domain-containing protein 8; DHHC-8; Zinc finger protein 378
Species
Homo sapiens (Human)
Expression Region
1-765
Target Protein Sequence
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLA NFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHC SVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGA AHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCCGNV EHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSK GSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPA FPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPL SASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFAPHALPNRNGSLSYD SLLNPGSPGGHACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVR YDNLSRTIMASIQERKDREERERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGP ALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSSVSRAPRTSSSSLQADQASSNAPGPRP SSGSHRSPARQGLPSPPGTPHSPSYAGPKAVAFIHTDLPEPPPSLTVQRDHPQLKTPPSK LNGQSPGLARLGPATGPPGPSASPTRHTLVKKVSGVGGTTYEISV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates and therefore functions in several unrelated biological processes. Through the palmitoylation of ABCA1 regulates the localization of the transporter to the plasma membrane and thereby regulates its function in cholesterol and phospholipid efflux. Could also pamitoylate the D(2) dopamine receptor DRD2 and regulate its stability and localization to the plasma membrane. Could also play a role in glutamatergic transmission.
Gene References into Functions
  1. the association between the COMT Val158Met and ZDHHC8 rs175174 single nucleotide polymorphism and the susceptibility to schizophrenia through a case-control study involving a population from the North Region of Brazil, was investigated. PMID: 28562378
  2. These data suggest that ZDHHC8 may play a role in cortical volumes in patients with schizophrenia. PMID: 23403413
  3. increased corpus callosum volume in children with 22q11DS is associated with ZDHHC8 polymorphism. PMID: 22763378
  4. Consistently negative associations with schizophrenia were found in the rs175174 polymorphism PMID: 20661937
  5. The present study provides the first evidence that ZDHHC8 polymorphisms on the 22q11 locus are associated with smooth pursuit eye movement (SPEM)abnormality in a Korean population. PMID: 20468065
  6. genotyped three genetic variants within the ZDHHC8 locus and conducted association studies in both population- and family-based samples of the Han Chinese population PMID: 15489219
  7. Because our sample size provided quite high power, ZDHHC8 may not play a major role in Japanese schizophrenia and our results did not support the gender-specific effect of this SNP. PMID: 15631889
  8. Single nucleotide polymorphism is not associated with chromosome 22 deletion or schizophrenia. PMID: 17728672

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Tissue Specificity
Widely expressed.
Database Links

HGNC: 18474

OMIM: 608784

KEGG: hsa:29801

STRING: 9606.ENSP00000384716

UniGene: Hs.63128

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1