Recombinant Human Prostasin (PRSS8)

Code CSB-CF623091HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PRSS8
Uniprot No.
Alternative Names
PRSS8; Prostasin; Channel-activating protease 1; CAP1; Serine protease 8
Species
Homo sapiens (Human)
Expression Region
45-322
Target Protein Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQ LDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPN GLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCA GYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSK VTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possesses a trypsin-like cleavage specificity with a preference for poly-basic substrates. Stimulates epithelial sodium channel (ENaC) activity through activating cleavage of the gamma subunits (SCNN1G).
Gene References into Functions
  1. limited role for HAI-2 in the inhibition of matriptase and prostasin is the result of its primarily intracellular localization in basal and spinous layer keratinocytes, which probably prevents the Kunitz inhibitor from interacting with active prostasin or matriptase PMID: 29438412
  2. PRSS8 was downregulated in glioma tissues.PRSS8 role in the glioma cell proliferation, migration, and invasion. PMID: 27983922
  3. PRSS8 acts as a tumor suppressor in colorectal cancer PMID: 27050145
  4. Data show that PRSS8 was reduced in esophageal squamous cell carcinomas (ESCC) tissues and the reduction of PRSS8 was associated with poor differentiation and shorter survival time. PMID: 27081034
  5. Studies in colonic T84 cell monolayers revealed that barrier disruption by the colitis-associated Th2-type cytokines, IL-4 and IL-13, down-regulates matriptase as well as prostasin through phosphorylation of the transcriptional regulator STAT6 PMID: 28490634
  6. PRSS8 may serve as a tumour suppressor in hepatocellular carcinoma progression. PMID: 27915333
  7. Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of ovarian cancer. PMID: 27036110
  8. It is concluded that prostasin protein level change is less likely to be causally involved in placental dysfunction in preeclampsia. PMID: 26867056
  9. In urinary exosomes, NCC and prostasin had a diurnal pattern parallel to ADH and aquaporin 2, confirming that, in healthy subjects, both prostasin and NCC relate to water balance. PMID: 25931204
  10. Polymorphism of the prostasin gene is closely associated with poor pregnancy outcomes of early-onset severe preeclampsia. PMID: 26252104
  11. Prostasin regulate the Lin28/Let-7 loop in ovarian cancer cells. PMID: 25188517
  12. The higher frequency of C allele of prostasin gene at rs12597511 is associated with severe preeclampsia. PMID: 24890150
  13. Prostasin repress cancer cells and contribute to chemoresistance by modulating the CASP/PAK2-p34/actin pathway. PMID: 24434518
  14. Our study suggested that Axl and prostasin expression may be closely related to carcinogenesis, metastasis, and prognosis of ovarian adenocarcinoma. PMID: 23707658
  15. urinary prostasin correlates with the aldosterone to renin ratio, and it is physiologically modulated by natriuresis in normotensive individuals PMID: 23344129
  16. prostasin is a non-enzymatic co-factor for matriptase activation PMID: 23673661
  17. Prostasin requires expression of endogenous matriptase to stimulate barrier formation since matriptase depletion by siRNA silencing abrogates prostasin barrier-forming activity. PMID: 23443662
  18. Essential hypertension in Xinjiang Kazakhs is not associated with the 2827C>T polymorphism in the prostasin gene. PMID: 20078940
  19. prostasin is present, mature and active on the apical surface of wild-type and cystic fibrosis bronchial epithelial cells PMID: 22582115
  20. Study does not provide evidence of a major role of prostasin variation in blood pressure modulation. PMID: 21933610
  21. Expression of matriptase and prostasin is closely correlated in breast cancer cell lines and in breast cancer tissues. Matriptase and prostasin display a near identical spatial expression pattern in the epithelial compartment of breast cancer tissue. PMID: 21678412
  22. Transport via the transcytotic pathway makes prostasin available as a substrate for matriptase. PMID: 21148558
  23. the matriptase-prostasin proteolytic cascade is tightly regulated by two mechanisms: 1) prostasin activation temporally coupled to matriptase autoactivation and 2) HAI-1 rapidly inhibiting not only active matriptase but also active prostasin PMID: 20696767
  24. prostasin is overexpressed in many epithelial ovarian cancers; a potential tumor marker PMID: 19606239
  25. Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor. PMID: 19911255
  26. Luciferase assay using CYP11B2 promoter revealed that prostasin significantly increased the transcriptional activity of CYP11B2. PMID: 20204133
  27. Prostasin may regulate trophoblast cell proliferation via modulating the EGFR-MAPK signaling pathway. PMID: 20089521
  28. In the in vitro cultured human choriocarcinomal JEG-3 cells, treatment with functional antibody against prostasin led to promotion in cell invasion capability, as well as increase in the production of MMP-2, MMP-26, TIMP-1, and TIMP-4. PMID: 19847458
  29. Loss of prostasin expression in bladder transitional cell carcinomas is associated with epithelial-mesenchymal transition. PMID: 19849847
  30. protease-mediated regulation of sodium absorption is a function of human airway epithelia, and prostasin is a likely candidate for this activity. PMID: 11756432
  31. prostasin is a major regulator of ENaC-mediated Na+ current in DeltaF508 cystic fibrosis epithelia PMID: 15246975
  32. prostasin is a channel activating protease; analysis of its substrate specificity PMID: 15474520
  33. HAI-1B is a potential physiological regulator of prostasin function PMID: 16103126
  34. Dihydrotestosterone regulates prostasin expression in prostate cells via sterol-regulatory element-binding protein stimulation and SLUG repression of prostasin promoter PMID: 16541421
  35. The PRSS8 gene was shown to effectively separate these two tumor(chromophobe renal cell carcinoma (RCC) and benign oncocytoma) groups by quantitative reverse transcription-PCR using fresh tissue samples, with similar trends seen on formalin-fixed tissues. PMID: 17145811
  36. Data show that prostasin induces protease-dependent and independent molecular changes in the human prostate carcinoma cell line PC-3. PMID: 17532063
  37. reduced activity of a matriptase-prostasin proteolytic cascade is the etiological origin of human ARIH and provides an important mouse model for the exploration of matriptase function in ARIH PMID: 17940283
  38. prostasin, an upstream prostasin-activating protease, and PN-1 regulate Na+ absorption in the airway and that abnormal prostasin expression contributes to excessive proteolytic activation of ENaC in cystic fibrosis patients PMID: 18310226
  39. Genetic variation of the prostasin gene may be implicated in the development of hypertension in youths. PMID: 18583984
  40. crystallographic analysis of prostasin PMID: 18922802
  41. Suggest that urinary prostasin could be a novel biomarker and/or mechanism for renal pressure natriuresis in normotensive black adolescents. PMID: 19127211
  42. it is not clear, at the present time, whether endogenous aldosterone regulates prostasin expression or vice versa PMID: 19262497
  43. study presents structures of the extracellular domain of active prostasin in several forms; of particular interest is the S1 subsite loop which opens and closes in response to basic residues or divalent ions, directly binding Ca(+2) cations PMID: 19388054
  44. the mRNA level of PN-1 is significantly elevated in colorectal cancer tissue PMID: 19555470

Show More

Hide All

Subcellular Location
[Prostasin]: Cell membrane; Single-pass membrane protein.; [Prostasin light chain]: Secreted, extracellular space. Note=Found in the seminal fluid. Secreted after cleavage of its C-terminus.; [Prostasin heavy chain]: Secreted, extracellular space. Note=Found in the seminal fluid. Secreted after cleavage of its C-terminus.
Protein Families
Peptidase S1 family
Tissue Specificity
Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.
Database Links

HGNC: 9491

OMIM: 600823

KEGG: hsa:5652

STRING: 9606.ENSP00000319730

UniGene: Hs.75799

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1