Recombinant Human Protein orai-2 (ORAI2)

Code CSB-CF853504HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ORAI2; C7orf19; CBCIP2; TMEM142B; PP1729; Protein orai-2; CAP-binding protein complex-interacting protein 2; Transmembrane protein 142B
Species
Homo sapiens (Human)
Expression Region
1-254
Target Protein Sequence
MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKL KASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTCILP NVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARR QPGPPPGPGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEELHKL KVQLDGHERSLQVL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.
Gene References into Functions
  1. ORAI1-3, are preferentially expressed in proximal tubular epithelial cells and downregulated in patients with diabetic nephropathy. PMID: 29203863
  2. findings provide evidence for a role for Orai1 and Orai2, in SOCE and migration in the human HL60 promyeloblastic cell line PMID: 27865925
  3. results identified the ORAI-NOX2 feedback loop as a determinant of monocyte immune responses. PMID: 26956485
  4. Orai1, Orai2 and STIM1 form functional Ca(2+) release-activated Ca(2+) channels in OUMS-27 cells (chondrocytes) and that these complexes are responsible for sustained Ca(2+) entry in response to agonist stimulation. PMID: 25769459
  5. Orai1 but not Orai2 plays a major role in the influx of extracellular Ca2+ into and mediator release from HLMCs following their activation PMID: 24040356
  6. Orai1 and Orai2 operate in a STIM-dependent manner, Orai3 does not interact with STIM isoforms upon calcium store depletion in platelets. PMID: 22640869
  7. With these data we show a new Ca(2)(+) entry pathway linked to the Ca(2)(+)/inositolphosphate second-messenger system in RPE cells which help to further understand regulatory pathways of agonists. PMID: 20607548
  8. Results suggest that Orai1, -2, and -3 channels are similarly inhibited by extracellular calcium, indicating similar affinities for Ca(2+) within the selectivity filter. PMID: 17452328
  9. The effects of 2-aminoethoxydiphenyl borate on orai1, orai2, orai3 metabolism in HEK293 cells with and without STIM1 are reported. PMID: 18403424
  10. analysis of activation of Orai1-3 channels by a STIM1 coiled-coil mutant PMID: 19506081
  11. Data show that the fast Ca(2+)-dependent inactivation is mediated by three conserved glutamates in the C termini (CT) of Orai2 and Orai3, which show prominent fast Ca(2+)-dependent inactivation compared with Orai1. PMID: 19706554

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Orai family
Database Links

HGNC: 21667

OMIM: 610929

KEGG: hsa:80228

STRING: 9606.ENSP00000348752

UniGene: Hs.363308

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1