Recombinant Human Putative P2Y purinoceptor 10(P2RY10)

Code CSB-CF017327HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O00398
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLC RFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYAS ICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKS CFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQK ALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLL DPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Source in vitro E.coli expression system
Gene Names P2RY10
Protein Names Recommended name: Putative P2Y purinoceptor 10 Short name= P2Y10 Alternative name(s): P2Y-like receptor
Expression Region 1-339
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative receptor for purines coupled to G-proteins.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Weakly expressed in blood leukocytes.
Database Links

HGNC: 19906

OMIM: 300529

KEGG: hsa:27334

STRING: 9606.ENSP00000171757

UniGene: Hs.296433

Related Products

P2RY10 Proteins

P2RY10 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.