Recombinant Human RING finger protein 175(RNF175)

Code CSB-CF019858HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8N4F7
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAAGTAARKAAPVLEAPPQQEQLSHTKLSAEDTWNLQQERMYKMHRGHDSMHVEMILIFL CVLVIAQIVLVQWRQRHGRSYNLVTLLQMWVVPLYFTIKLYWWRFLSMWGMFSVITSYIL FRATRKPLSGRTPRLVYKWFLLIYKLSYAFGVVGYLAIMFTMCGFNLFFKIKARDSMDFG IVSLFYGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKIIVELDE EGLIENTYQLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMISNPWERTHFLYGQI LDWLRYLVAWQPVVIGIVQGIIYSLGLE
Source in vitro E.coli expression system
Gene Names RNF175
Protein Names Recommended name: RING finger protein 175
Expression Region 1-328
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

HGNC: 27735

KEGG: hsa:285533

STRING: 9606.ENSP00000340979

UniGene: Hs.388364

Related Products

RNF175 Proteins

RNF175 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.