Recombinant Human Receptor-transporting protein 1(RTP1)

Code CSB-CF020577HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P59025
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV
Source in vitro E.coli expression system
Gene Names RTP1
Protein Names Recommended name: Receptor-transporting protein 1
Expression Region 1-263
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Specifically promotes functional cell surface expression of olfactory receptors, but not of other GPCRs.
Subcellular Location Cell membrane, Single-pass type III membrane protein
Protein Families TMEM7 family
Tissue Specificity Expressed in testis.
Database Links

HGNC: 28580

OMIM: 609137

KEGG: hsa:132112

STRING: 9606.ENSP00000311712

UniGene: Hs.518480

Related Products

RTP1 Antibodies

RTP1 Antibodies for Homo sapiens (Human)

RTP1 Proteins

RTP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.