Recombinant Human Relaxin-3 receptor 1(RXFP3)

Code CSB-CF873646HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NSD7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY
Source in vitro E.coli expression system
Gene Names RXFP3
Protein Names Recommended name: Relaxin-3 receptor 1 Short name= RLN3 receptor 1 Alternative name(s): G protein-coupled receptor SALPR G-protein coupled receptor GPCR135 Relaxin family peptide receptor 3 Somatostatin- and angiotensin-like pep
Expression Region 1-469
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for RNL3/relaxin-3. Binding of the ligand inhibit cAMP accumulation.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed predominantly in brain regions. Highest expression in substantia nigra and pituitary, followed by hippocampus, spinal cord, amygdala, caudate nucleus and corpus callosum, quite low level in cerebellum. In peripheral tissues, relatively high leve
Database Links

HGNC: 24883

OMIM: 609445

KEGG: hsa:51289

STRING: 9606.ENSP00000328708

UniGene: Hs.170146

Related Products

RXFP3 Antibodies

RXFP3 Antibodies for Homo sapiens (Human)

RXFP3 Antibodies for Human

RXFP3 Proteins

RXFP3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.