Recombinant Human Somatostatin receptor type 1 (SSTR1)

Code CSB-CF022724HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
SSTR1; Somatostatin receptor type 1; SS-1-R; SS1-R; SS1R; SRIF-2
Species
Homo sapiens (Human)
Expression Region
1-391
Target Protein Sequence
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and Na(+)/H(+) exchanger via pertussis toxin insensitive G proteins.
Gene References into Functions
  1. High SSTR1 expression is associated with hepatocellular and cholangiocellular carcinomas in tumor capillaries. PMID: 29282035
  2. Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%). PMID: 26474434
  3. An immunohistochemical investigation of the expression of somatostatin receptor subtypes PMID: 25962406
  4. The UMB-7 may prove of great value in the identification of sst1-expressing tumors during routine histopathological examinations. This may open up new routes for diagnostic and therapeutic intervention. PMID: 23466804
  5. SSTR-PET showed high sensitivity for imaging bone, soft tissue and brain metastases, and particularly in combination with CT had a significant impact on clinical stage and patient management. PMID: 24742330
  6. SSTRs are overexpressed in primary pigmented nodular adrenocortical disease tissues in comparison with normal adrenal cortex PMID: 24512486
  7. Activated/phosphorylated pMAPK 44/42 was detected in 82% of medulloblastomas, all subtypes, and in 62.5% of primitive neuroectodermal tumors with coexpression of SSR1 in one third. PMID: 23455179
  8. Somatostatin receptor imaging (SRI) using SPECT or PET as a whole-body imaging technique has become a crucial part of the management of Neuroendocrine tumors PMID: 24106690
  9. Tumor cells in the tissue samples of the patients diagnosed with advanced-stage hepatocellular carcinoma expressed a high proportion of SSTR1 and SSTR5. PMID: 24634938
  10. Somatostatin receptor 1 is a novel methylated gene driven by EBV infection in gastric cancer cells and acts as a potential tumour suppressor. PMID: 23722468
  11. Data demonstrate that cells transfected with SSTR1 or SSTR1/5 negatively regulates EGF mediated effects attributed to the inhibition of EGFR phosphorylation. PMID: 21419811
  12. Data show that the mRNA levels of SSTR1, SSTR2, SSTR3, and SSTR5 were high in PET compared with AC, whereas the expression of SSTR4 was low in PET and AC. PMID: 20717067
  13. Studies show that this study may be the basis for further functional studies to evaluate the role of somatostatin receptors sst1 to sst5 in the diabetic state. PMID: 20182388
  14. Overexpressed in endomterium inendometriosis. PMID: 20739383
  15. The summarized expression pattern of SSTR in the investigated neuroendocrine tumors in our material was: SSTR 1> SSTR 5> SSTR 3> SSTR 2A> SSTR 2B. PMID: 20529830
  16. SSTR1 had higher expression in patients that had normalized GH and IGF-I. There was a positive correlation between the percentage of tumor reduction by octreotide-lar and SSTR1 expression. PMID: 19330452
  17. SSTR transcripts are expressed and functional in retroorbital fibroblasts. SSTR1 is expressed in Grave's disease and octreotide inhibits retroorbital cell growth, explaining the SRIH therapeutic effect. PMID: 11753241
  18. SSTRs 1-5 are heterogeneously expressed in gastroenteropancreatic endocrine tumors PMID: 12021920
  19. selective activation reduces cell growth and calcitonin secretion in a human medullary thyroid carcinoma cell line PMID: 12359227
  20. the expression of somatostatin (SS) and SS receptor (SSR) subtype 1 (sst1), sst2A, and sst3 in normal human thymic tissue PMID: 12376335
  21. somatostatin receptor transcripts were found in lymphocytes both from Graves' ophthalmopathy retroorbital tissues and blood samples, with levels of expression of SST1, -2, and -4 mRNA higher than those of the SST3 and -5 transcripts PMID: 12414882
  22. localization and expression in human prostatic tissue and prostate cancer cell lines PMID: 12474541
  23. SSTR1 selective activation inhibits hormone secretion and cell viability in GH- and PRL-secreting adenomas in. SRIF analogs with affinity for SSTR1 may be useful to control hormone hypersecretion and reduce neoplastic growth of pituitary adenomas. PMID: 12788890
  24. activation of hSSTR1 is not necessary for heterodimeric assembly PMID: 15247250
  25. transcriptional regulation of the human SST1 was analyzed in the present study PMID: 17533578
  26. Analysis of orbital tissues reveals upregulation of SSTR1 and -2 in a group of Graves' ophthalmopathy (GO)patients. Adipogenesis, a process occurring in GO orbits, provides one possible explanation for some of the observed increase. PMID: 17848636
  27. The most prominent candidates associated with aggressive prostate cancer were SSTR1 and genes related to proliferation, including TOP2A. PMID: 18347174
  28. the expression of SSTR-1 mRNA in human pancreatic cancer tissue specimens, and investigated the effect of SSTR-1 overexpression on cell proliferation, cell cycle, and tumor growth in a subcutaneous nude mouse model. PMID: 18823376
  29. Immunohistochemistry stufy of SSTR1 in prostate tissue from patients with bladder outlet obstruction showed that greatest proportion of basal cells showed a moderate intensity, strong immunoreactivity being observed only in 18.1% of cells. PMID: 18936524
  30. To the best of our knowledge, this is the first report describing crosstalk/interactions between SSTRs and ErbBs. PMID: 19070659
  31. Both SSTR1 and 2 mRNA levels in SCA were greater than Cushing disease, while SSTR1 mRNA levels, but not SSTR2, in silent corticotroph adenoma were also greater than non-functioning pituitary tumor. PMID: 19318729

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Fetal kidney, fetal liver, and adult pancreas, brain, lung, jejunum and stomach.
Database Links

HGNC: 11330

OMIM: 182451

KEGG: hsa:6751

STRING: 9606.ENSP00000267377

UniGene: Hs.248160

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1