Recombinant Human Steryl-sulfatase (STS)

Code CSB-CF022883HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
STS
Uniprot No.
Alternative Names
STS; ARSC1; Steryl-sulfatase; Arylsulfatase C; ASC; Estrone sulfatase; Steroid sulfatase; Steryl-sulfate sulfohydrolase
Species
Homo sapiens (Human)
Expression Region
22-583
Target Protein Sequence
HAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLAASPLCTPSRAA FMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMSC HSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLA ALNCLGLLHVPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLT QRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQ ILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGGIRVPGI LRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEF LFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCFGSYVTHHDPPL LFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQL CCPSTGLSCQCDREKQDKRLSR
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the conversion of sulfated steroid precursors, such as dehydroepiandrosterone sulfate (DHEA-S) and estrone sulfate to the free steroid.
Gene References into Functions
  1. Polymorphisms of STS gene is associated with attention-deficit/hyperactivity disorder. PMID: 28367959
  2. STS is increased in preeclamptic placentas and maternal whole blood. Our data suggests that STS may affect sFlt1 secretion by regulating sFlt1-i13 transcription, and not via alterations in syncytialisation. PMID: 27871476
  3. This study reveals that STS is a key player of steroid biosynthesis regulating the availability of circulating cholesterol. PMID: 27531568
  4. In contrast to the situation in boys with ADHD, in healthy men, the G-allele at rs17268988 of STS is associated with enhanced cognition. PMID: 28293481
  5. miR-661 overexpression sensitized tumors to TRAIL or STS induced apoptosis in a xenograft mouse model, and these effects were attenuated by co-expression of CYC1. PMID: 28391262
  6. Collectively, STS point mutations demonstrate restricted localization, causing efficient impairment of the corresponding enzyme activity, and are more unlikely to be responsible for the phenotypic heterogeneity in XLRI subjects PMID: 26387488
  7. STS expression was not significantly associated with DFS and OS, despite positive STS expression in 27% of endometrial cancer patients. Therefore, the role of STS as a prognostic factor in patients with endometrial cancer remains unclear and requires further research. PMID: 26996578
  8. The induced STS facilitates the conversion of inactive estrogen sulfates to active estrogens, which in return attenuates the NF-kappaB-mediated inflammation. PMID: 26220752
  9. The antagonistic actions of glucocorticoids and NFkB on STS expression are similar to the regulation of inflammatory response proteins PMID: 26631368
  10. Letter/Case Report: novel nonsense mutation in the STS gene in X-linked ichthyosis. PMID: 26421812
  11. Data show that both estrogen sulfatase (STS) and estrogen sulfotransferase (EST) were highly expressed in the human umbilical vein endothelial cells (HUVECs). PMID: 26458420
  12. Effects of steroid hormone on estrogen sulfotransferase and on steroid sulfatase expression in endometriosis tissue and stromal cells PMID: 26723541
  13. represents one of the major pathways in regenerating biologically active steroids in both steroidogenic and nonsteroidogenic tissues [review] PMID: 26213785
  14. Our analyses show that the two phenotypes in our patient are due to independent genetic defects: a genomic rearrangement involving the Kallmann syndrome 1 gene and a point mutation of the steryl-sulfatase gene. PMID: 25726327
  15. In both arm and subumbilical skin biopsy of patients with idiopathic hirsutism, there was an up-regulation of STS mRNA expression. PMID: 26194504
  16. Genetic variation in ARSC may be associated with change in mammographic density after women stop using estrogen-progestin therapy. PMID: 25499601
  17. STS is present in human pre-osteoblastic bone cells and that it can influence bone cell growth PMID: 25042472
  18. complete deletion in Pakistani families with x-linked ichthyosis PMID: 24480088
  19. results suggest that steroid sulfatase expression can be decreased in the process of large intestinal carcinogenesis PMID: 23916543
  20. Data suggest that expression of STS and 17beta-hydroxysteroid dehydrogenase isoenzymes is up-regulated in subcutaneous abdominal fat of morbidly obese women as compared with morbidly obese men. PMID: 24081738
  21. Microdeletion within Xp22.3 containing STS with aCGH in an individual with suspected pre-Descemet corneal dystrophy and X-linked ichthyosis demonstrates the clinical utility of copy number variation analysis. PMID: 23807007
  22. IGF-II induces steroid sulfatase expression via a PI3-kinase/Akt-NF-kappaB signaling pathway in PC-3 cells and may induce estrogen production and estrogen-mediated carcinogenesis. PMID: 24055520
  23. Genetic variants in SULT2A1, PAPSS2, and STS do not predispose to polycystic ovary syndrome. PMID: 23861462
  24. no difference in placental activity found between women with polycystic ovarian syndrome and controls PMID: 23122578
  25. Genetic variants affecting steroid sulfatase expression and/or activity could influence the function of brain regions perturbed in attention deficit hyperactivity disorder (ADHD). PMID: 21255266
  26. Filaggrin defects can synergize with steroid sulfatase deficiency to exacerbate the ichthyosis phenotype. PMID: 21945601
  27. Recent results of STS and EST in several estrogen-dependent carcinomas, are summarised. PMID: 21073915
  28. This timely review concentrates on recent advances in steroid sulfatase research. PMID: 21693170
  29. Case Report: Report novel point mutation in the STS gene in a patient with X-linked recessive ichthyosis. PMID: 21530180
  30. Genetic variation in the STS gene may be implicated in ADHD susceptibility and one polymorphism may be associated with lower STS mRNA expression as well as being more prevalent in female ADHD homozygotes. PMID: 20862695
  31. Recessive X-linked ichthyosis is caused by a deficiency in steroid sulphatase (STS), whose gene has been located on the X chromosome. PMID: 20236202
  32. Six novel single nucleotide polymorphisms of the steroid sulfatase gene in a Japanese population. PMID: 20814163
  33. A significant increment of STS followed exemestane neoadjuvant therapy of postmenopausal ER-positive breast carcinoma. This may represent the compensatory response of breast carcinoma tissues to estrogen depletion. PMID: 20151319
  34. Both steroid sulfatase and filaggrin mutations are found in X-linked ichthyosis. PMID: 20149601
  35. Analysis of deletions indicates complex origin, apart from homologous recombination, of deletion mutants. PMID: 11844872
  36. in the human hair follicle, concentrates in the dermal papilla. PMID: 11886493
  37. Regulation of estrogen activity in human endometrium: effect of IL-1beta on steroid sulfatase activity in human endometrial stromal cells. PMID: 11996939
  38. data demonstrate that LNCaP prostate cancer cells contain a steryl sulfatase with properties similar to that found in human breast cancer cells PMID: 12231117
  39. The structure of this enzyme, purified from the microsomal fraction of human placentas, determined by x-ray crystallography. PMID: 12657638
  40. Levels of STS and estrogen sulfotransferase mRNA and activity may be significantly associated with degree of atherosclerotic changes in female aorta, which may be related to cytokines produced in situ, such as IL-1beta, in human atherosclerotic lesions. PMID: 14507642
  41. estrogen-dependent cell growth of the estrogen sulfatase-transfected cell clones was found to be abolished, due to the enhanced sulfoconjugation of estrogen PMID: 14556660
  42. Steroid sulfatase increases steroid acute regulatory protein expression level and stimulates steroid production. PMID: 14969586
  43. SSase is concentrated in lamellar bodies (LB), and secreted into the SC interstices, along with other LB-derived lipid hydrolases. There, it degrades CSO4, generating some cholesterol for the barrier PMID: 15009711
  44. Strong activity and mRNA expression of DHEAS desulfating STS was found, twice as high in cerebral neocortex than in subcortical white matter. Cerebral STS resembled the characteristics of the known placental enzyme PMID: 15056284
  45. Dehydroepiandrosterone blood levels are influenced by a steroid sulfatase polymorphism following acute resistance exercise. PMID: 15152080
  46. Gonadotropin-releasing hormone agonist (leuprolide)inhibits estrone sulfatase expression in cystic endometriosis in the ovary. PMID: 15302278
  47. Increased steroid sulfatase expression is associated with estrogen-dependent endometrial carcinomas PMID: 15355916
  48. Findings of steroid sulfatase localized in the cytoplasm of the cumulus cells and expression of STS mRNA suggest a local steroidal regulation mechanism in cumulus cells. PMID: 16084891
  49. Studies on the localization of steroid sulfatase were performed. PMID: 16399357
  50. Corticotrophin-releasing hormone (CRH) increased whereas alpha-helical CRH decreased the mRNA levels of STS, CYP19A1, and HSD17B1, the key enzymes for estrogen synthesis. PMID: 16467490

Show More

Hide All

Involvement in disease
Ichthyosis, X-linked (IXL)
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, microneme membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Sulfatase family
Database Links

HGNC: 11425

OMIM: 300747

KEGG: hsa:412

STRING: 9606.ENSP00000217961

UniGene: Hs.522578

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1