Recombinant Human Synaptophysin(SYP)

Code CSB-CF023024HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P08247
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence KETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAG SGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
Source in vitro E.coli expression system
Gene Names SYP
Protein Names Recommended name: SynaptophysinAlternative name(s): Major synaptic vesicle protein p38
Expression Region 224-313
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).
Involvement in disease Mental retardation, X-linked 96 (MRX96)
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Multi-pass membrane protein, Cell junction, synapse, synaptosome
Protein Families Synaptophysin/synaptobrevin family
Tissue Specificity Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype.
Database Links

HGNC: 11506

OMIM: 300802

KEGG: hsa:6855

STRING: 9606.ENSP00000263233

UniGene: Hs.632804

Related Products

SYP Antibodies

SYP Antibodies for Homo sapiens (Human)

SYP Proteins

SYP Proteins for Homo sapiens (Human)

SYP ELISA Kit

SYP ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.