Recombinant Human Synaptophysin (SYP)

In Stock
Code CSB-CF023024HU
Abbreviation Recombinant Human SYP protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SYP
Uniprot No.
Research Area
Neuroscience
Alternative Names
Major synaptic vesicle protein p38
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-313aa
Target Protein Sequence
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.
Gene References into Functions
  1. Syp can be quantified on circulating tumor cells and that Syp expression correlates with resistance to abiraterone and enzalutamide in castration resistant prostate cancer. PMID: 29289429
  2. Report of a novel SYP mutation identified in a patient with a severe neurodevelopmental disorder. Mutation does not impact on synaptic vesicles endocytosis or trafficking of common cargoes. However it is unable to support sybII retrieval in synaptophysin knockout neurons. It fully restores plasma membrane levels of sybII, suggesting that activity-dependent trafficking of sybII is specifically affected by this mutation. PMID: 28887151
  3. The expression of MAP2 and SYP proved most relevant to neurocognitive functioning in HIV-infected patients. PMID: 26637429
  4. Synaptophysin-positive epithelial proliferations suggest breast neoplasms. PMID: 28630050
  5. Suggest that INSM1 is valuable for identification of the high-grade thoracic neuroendocrine carcinomas that are sometimes negative for synaptophysin, chromogranin, and CD56. PMID: 28719469
  6. High synaptophysin expression is associated with neuroendocrine differentiation in colorectal cancer. PMID: 28351413
  7. Study reveals the presence of two selected neuronal markers, MAP-2 and SYP mRNAs and protein expression, in eutopic endometrium and in endometriotic lesions. PMID: 26604067
  8. Anomalous expression of all intermediate filament proteins and synaptophysin was found in significant subsets of malignant melanoma. PMID: 26022451
  9. Docosahexaenoic acid-containing phosphatidylcholines and PSD-95 decrease after loss of synaptophysin and before neuronal loss in patients with Alzheimer's disease. PMID: 25410733
  10. This study demonstrated that synaptophysin was significantly lower in Down syndrome with Alzheimer disease compared with Down syndrome alone and similar to sporadic Alzheimer disease. PMID: 24927707
  11. The results of this study suggested that SYP may be primarily associated with ADHD-I and its genetic mechanism may be gender-specific. PMID: 23726717
  12. The paucity or absence of synaptophysin-positive cells in all three phenotypes of Barrett's mucosa might mirror a sequela of chronic inflammation caused by the particular pathogenic bacteria present in the immediate oesophageal microenvironment. PMID: 23763443
  13. Data suggest that multi-antibody assay of TTF1, Vimentin, p63 CD56, chromogranin and synaptophysin may be of special value, especially in diagnosing small biopsies. PMID: 23418554
  14. the author showed that, in cutaneous basal cell carcinoma, the expression of NCAM and c-KIT was high, PDGFRA was intermediate, and chromogranin A and synaptophysin was relatively low PMID: 23292839
  15. Depressed patients showed significant decreases in synaptophysin (SYN) and VGLUT1 expression. PMID: 23022470
  16. Lower levels of synaptophysin were found in the visual cortex of dementia with Lewy bodies patients compared to controls. PMID: 23242284
  17. Normal goblet cells found in duodenal adenomas express synaptophysin. PMID: 22843923
  18. The data of this study suggested that the common polymorphisms of the SYP gene appear not to play a major role in conferring susceptibility to schizophrenia. PMID: 22348818
  19. This is the first report of immunoreactivity for inhibin-alpha and synaptophysin in synovial sarcoma PMID: 22055401
  20. NCAM1, SYPT and CGA expressions are differently regulated by neuroendocrine phenotype-specific transcription factors in lung cancer cells. PMID: 22449227
  21. Finding that synaptophysin is produced by Paneth cells adds new information which might help to unravel the riddle of the ultimate biological significance of these puzzling cells. PMID: 22210727
  22. The expression of synaptophysin and GAD67 was downregulated in the basolateral nucleus of schizophrenics. PMID: 22099865
  23. Prescence of of APOEepsilon4 allele and MAPT H2 haplotype in frontotemporal lobar degeneration had a significant influence on the expression of synaptophysin and SNAP-25 PMID: 21073671
  24. Significant decreases in synaptophysin levels are observed in hippocampal neurons from Alzheimer's disease patients. PMID: 20847448
  25. during prenatal development synaptophysin expression increased gradually in the red nucleus PMID: 12077483
  26. we have identified a functional binding site for REST in the first intron of the human synaptophysin gene indicating that REST blocks human synaptophysin gene transcription through an intronic neuron-specific silencer element. PMID: 12492469
  27. AP180 had an overall expression similar to synaptophysin, the immunoreactivity for the two proteins did not always co-localize. PMID: 12493563
  28. This protein was found in cells of adrenal cortical neoplasms. PMID: 12575533
  29. expression and localization of chromogranin A (CgA), chromogranin B (CgB), synaptophysin, and insulin were ultrastructurally studied with the immunogold technique in porcine and human pancreatic islet neuroendocrine cells PMID: 12826904
  30. Synaptophysin immunoreactivity was significantly reduced in both the inner and outer molecular layers of the dentate gyrus (both p<0.01 by paired t-test), but not in the hilus. In contrast to patients with schizophrenia. PMID: 15694236
  31. Synaptophysin was absent near neurons bearing clusters of oligomer Abeta, suggesting that accumulated oligomer Abeta, but not fibrillar Abeta, is closely associated with synaptic failure, a major cause of cognitive dysfunction. PMID: 16721760
  32. Results describe patterns of synaptophysin protein and mRNA expression in the human hippocampal formation from birth to old age. PMID: 16807900
  33. Synaptophysin regulates micro-opioid receptor trafficking and signaling. PMID: 17005904
  34. Overexpression of Synaptophysin is associated with squamous carcinoma and adenocarcinoma of the lung PMID: 17724707
  35. synaptophysin levels slowly increased from birth until age 5 and then increased more rapidly to peak in late childhood around age 10 then decrease until the adult level was reached by age 16 PMID: 17916412
  36. Synaptophysin(SYN) was correlated with mini-mental status examination scores. Frontal cortex SYN protein levels may protect neuronal function in oldest-old individuals and reflect compensatory responses that may be involved with maintaining cognition. PMID: 18006193
  37. Chromogranin A-, serotonin-, synaptophysin- and vascular endothelial growth factor-positive endocrine cells and the prognosis of colorectal cancer: an immunohistochemical and ultrastructural study. PMID: 18771509
  38. Additional immunohistochemical detection of neuroendocrine differentiation (chromogranin-A, synaptophysin, and neural-cell adhesion molecule) in non-small cell lung cancer is presently not of prognostic importance. PMID: 19652998
  39. Chromogranin A, synaptophysin and CK 20 were not expressed in any basal cell carcinoma PMID: 19724850

Show More

Hide All

Involvement in disease
Mental retardation, X-linked 96 (MRX96)
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families
Synaptophysin/synaptobrevin family
Tissue Specificity
Expressed in the brain, with expression in the hippocampus, the neuropil in the dentate gyrus, where expression is higher in the outer half of the molecular layer than in the inner half, and in the neuropil of CA4 and CA3.
Database Links

HGNC: 11506

OMIM: 300802

KEGG: hsa:6855

STRING: 9606.ENSP00000263233

UniGene: Hs.632804

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*