Recombinant Human Syndecan-2 (SDC2)

Code CSB-CF020889HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SDC2
Uniprot No.
Alternative Names
SDC2; HSPG1; Syndecan-2; SYND2; Fibroglycan; Heparan sulfate proteoglycan core protein; HSPG; CD antigen CD362
Species
Homo sapiens (Human)
Expression Region
19-201
Target Protein Sequence
ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis.
Gene References into Functions
  1. Methylation of SFRP1, SFRP2, SDC2, and PRIMA1 promoter sequences was observed in 85.1%, 72.3%, 89.4%, and 80.9% of plasma samples from patients with Colorectal cancer and 89.2%, 83.8%, 81.1% and 70.3% from adenoma patients, respectively. PMID: 28753106
  2. Emerging roles of SDC2 in epithelial and mesenchymal cancer progression has been summarized. (Review) PMID: 28940845
  3. data suggest that syndecan-2 induces extracellular shedding of E-cadherin and supports the acquisition of a fibroblast-like morphology by regulating MMP-7 expression in a colon cancer cell line PMID: 27270030
  4. SDC2 is overexpressed in Leri's pleonosteosis. The minor allele of a missense SDC2 variant, p.Ser71Thr, could confer protection against systemic sclerosis. PMID: 24442880
  5. In this review we considered the function of syndecan-2, the structure of syndecan-2 and its role in the formation of amyloid plaques. PMID: 25916113
  6. Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line. PMID: 24804215
  7. HIV matrix protein p17 is pro-fibrogenic through its interactions both with CXCR2 and syndecan-2 on activated HSCs PMID: 24736615
  8. The results demonstrate the importance of PDZ-binding domain of syndecan-2 for controlling LFA-1 affinity and cell adhesion. PMID: 24662262
  9. SDC2 expression was higher in skin melnaoma cells. It enhanced tyrosinase activity by increasing the membrane and melanosome localization of protein kinase CbetaII. UVB-induced up-regulation was required for UVB-induced melanin synthesis. PMID: 24472179
  10. syndecan 2 shows no changes associated to histological grade of Prostate cancer PMID: 24424718
  11. RhoA, but not RhoC was shown to be essential for the anchored phenotype of breast carcinoma cells that accompanied siRNA-mediated loss of syndecan-2. PMID: 24447566
  12. RKIP, LOX and SDC2 are coordinately regulated and collectively encompass a prognostic signature for metastasis-free survival in ER-negative breast cancer patients PMID: 23975428
  13. Taken together, these data suggest that IL-1alpha regulates extracellular domain shedding of syndecan-2 through regulation of the MAP kinase-mediated MMP-7 expression in colon cancer cells. PMID: 24613844
  14. Clinical validation of SDC2 methylation in serum DNA by quantitative methylation-specific PCR demonstrated a high sensitivity of 87.0% (95% CI, 80.0% to 92.3%) in detecting cancers. PMID: 23747112
  15. DNA from 4 HPV positive and 4 HPV negative fresh frozen primary HNSCC were subject to comprehensive genome-wide methylation profiling.Pathway analysis of 1168 methylated genes showed 8 signal transduction pathways (SDC2) of which 62% are hypermethylated. PMID: 23736812
  16. Taken together, these results suggest that the extracellular domain of syndecan-2 regulates the interaction of HCT116 human colon carcinoma cells with fibronectin. PMID: 23333331
  17. SDC-2 modulates TGFbeta2 transcriptional regulation via Smad2 signaling to facilitate fibrosarcoma cell adhesion. PMID: 23297089
  18. The repression of syndecan-2 by Wnt/beta-catenin/TCF signaling contributes to the resistance of osteosarcoma cells to doxorubicin. PMID: 22550000
  19. lower TCR/CD3 surface levels caused by syndecan-2 led to reduced TCR/CD3 responsiveness PMID: 22881146
  20. MC1R regulates melanoma cell migration via inhibition of syndecan-2 expression. PMID: 22493442
  21. SDC-2 is a novel (perineural) invasion-associated gene in PDAC which cooperates with K-ras to induce a more invasive phenotype. PMID: 22471946
  22. Notch receptors control their own activity by inducing the expression of syndecan-2, which then acts to propagate Notch signaling by direct receptor interaction. PMID: 22437834
  23. a specific glycochain is a receptor for dengue virus strain DEN2 16681 PMID: 22170634
  24. the data suggest that MMP-7 directly mediates shedding of syndecan-2 from colon cancer cells. PMID: 22227189
  25. Here the protein tyrosine phosphatase receptor CD148 is shown to be a key intermediary in cell adhesion to syndecan-2 extracellular domain, with downstream beta1 integrin-mediated adhesion and cytoskeletal organization. PMID: 21813734
  26. syndecan-2 was expressed preferentially in basal cells in benign tissue. In prostate cancer samples, syndecan 2 was expressed in granular-cytoplasmic localisation. PMID: 21317913
  27. HIV-1 p17 matrix protein interacts with heparan sulfate side chain of CD44v3, syndecan-2, and syndecan-4 proteoglycans expressed on human activated CD4+ T cells affecting tumor necrosis factor alpha and interleukin 2 production. PMID: 21482826
  28. the cytoplasmic domain of syndecan-2 regulates colon cancer cell migration via interaction with syntenin-1. PMID: 21569759
  29. The findings demonstrate that LRP1 and HSPG function in a cooperative manner to mediate cellular Abeta uptake and define a major pathway through which Abeta gains entry to neuronal cells. PMID: 21289173
  30. syndecan-2 and syndecan-4 regulate the compensatory effect of TG-FN on osteoblast cell adhesion and actin cytoskeletal formation in the presence of RGD peptides. PMID: 21036168
  31. RGD-independent cell adhesion via a tissue transglutaminase 2-fibronectin matrix promotes fibronectin fibril deposition and requires syndecan-4/2 and {alpha}5{beta}1 integrin co-signaling. PMID: 20929862
  32. Results support a potential role for syndecan-2 in pancreatic carcinogenesis and cancer progression. Expression of syndecan-2 might serve as a prognostic marker. PMID: 20683009
  33. Study results supported the potential role of SDC2 in prostatic carcinogenesis and cancer progression. PMID: 19786981
  34. these results suggest that syndecan-2 regulates cell migration of colon carcinoma cells through Tiam1-dependent Rac activation in colon cancer cells. PMID: 19962968
  35. syndecan's interactions with both CASK and neurofibromin are dependent on syndecan homodimerization. PMID: 20006588
  36. Identification of integrin alpha(M)beta(2) as an adhesion receptor on human peripheral blood monocytes for Cyr61 and connective tissue growth factor: immediate-early gene products expressed in atherosclerotic lesions.(integrin alpha(M)beta(2)) PMID: 12036876
  37. role in mediating adhesion and proliferation of colon carcinoma cells PMID: 12055189
  38. Ezrin N-terminal domain binds to the syndecan-2 cytoplasmic domain with an estimated K(D) of 0.71 microM and without the requirement of other proteins PMID: 12860416
  39. Mechanisms for the regulation of HSPG have been studied. PMID: 12860968
  40. Interleukin-8 binds to syndecan-2 on vascular endothelial cells. PMID: 14527339
  41. the HSPG T allele is a risk factor for the development of severe diabetic nephropathy in type 2 diabetic patients PMID: 14674716
  42. Syndecan-2 induces osteoblastic cell apoptosis through the JNK/Bax apoptotic pathway and the cytoplasmic domain of syndecan-2 is required for this action. PMID: 15936998
  43. the transmembrane domains are sufficient for inducing dimerization and transmembrane domain-induced oligomerization is crucial for syndecan-2 and syndecan-4 functions PMID: 16253987
  44. molecular complex most likely to obstruct RACK1 for functional attachment at syndecan-2, as revealed in cells transfected with oncogenic ras PMID: 16997272
  45. HSPGs are expressed on the membrane of myeloid leukemic cell lineages. PMID: 17035092
  46. heparanase-1 expression and heparan sulphate proteoglycan degradation are induced by estradiol in human endometrium PMID: 17261577
  47. these data suggested that both HSPG and CD81 are important for HCV entry. PMID: 17457918
  48. HSPG modulation of BMP signaling in myositis ossificans cells is reported. PMID: 17516498
  49. syndecan-2 acts as a suppressor for MMP-2 activation, causing suppression of metastasis PMID: 17623663
  50. There are pronounced tubulointerstitial HSPG alterations in primary kidney disease, which may affect the inflammatory response. PMID: 18032547

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Syndecan proteoglycan family
Database Links

HGNC: 10659

OMIM: 142460

KEGG: hsa:6383

STRING: 9606.ENSP00000307046

UniGene: Hs.1501

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1