Recombinant Human Threonylcarbamoyladenosine tRNA methylthiotransferase (CDKAL1)

Code CSB-CF716574HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CDKAL1
Uniprot No.
Alternative Names
CDKAL1; Threonylcarbamoyladenosine tRNA methylthiotransferase; CDK5 regulatory subunit-associated protein 1-like 1; tRNA-t(6A37 methylthiotransferase
Species
Homo sapiens (Human)
Expression Region
1-579
Target Protein Sequence
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTI PGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFR NSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLG QKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVD RAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILE HLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIAT DIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDL SRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIY ESGKHFMKGQPVSDAKVYTPSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDS ASSRMVLPMPRLHQDCALRMSVGLALLGLLFAFFVKVYN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t(6)A), leading to the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms(2)t(6)A) at position 37 in tRNAs that read codons beginning with adenine.
Gene References into Functions
  1. Non-significant association was seen in the two single nucleotide polymorphisms (SNPs) of CDKAL1 (rs7754840) and CDKN2A/2B (rs10811661) with gestational diabetes mellitus (GDM). PMID: 29544538
  2. chromosomal region 6p22.3 is a novel susceptibility locus for nsCL/P. The location of the risk variants within the CDKAL1 intronic sequence containing enhancer elements predicted to regulate the SOX4 transcription may suggest that SOX4, rather than CDKAL1, is a potential candidate gene for this craniofacial anomaly. PMID: 29403086
  3. More CDKAL1 variants are required to validate the association between CDKAL1 and gestational glycemic traits. PMID: 28502787
  4. Forced MT1E expression rescues both hypersensitivity of CDKAL1 mutant cells to glycolipotoxicity and pancreatic beta-cell dysfunction in vitro and in vivo. PMID: 28538172
  5. CDKAL1 gene is associated with development of type 2 diabetes. For the HHEX/IDE locus, such an association is absent. PMID: 29372795
  6. family-based GWAS of imputed SNPs revealed novel genomic variants in (or near) PTPRG, OSBPL6, and PDCL3 that influence risk for Alzheimer's Disease. rs7609954 in the gene PTPRG, rs1347297 in the gene OSBPL6, and rs1513625 near PDCL3. In addition, rs72953347 in OSBPL6 and two SNPs in the gene CDKAL1 showed marginally significant association with LOAD (rs10456232, P-value=4.76 x 10-7; rs62400067, P-value=3.54 x 10-7). PMID: 26830138
  7. The multivariate logistic regression analysis with reference to both alleles and genotypes of CDKAL1 SNPs showed significant association, suggesting an important role for this gene in the T2DM pathophysiology. INTERPRETATION & CONCLUSIONS: A significant association was seen of all the three SNPs of CDKAL1 and CDKN2A/B genes with T2DM but none of the two SNPs of HHEX. PMID: 27377502
  8. Study provides evidence that SNPs of JMJD1C and KCNQ1 are prospectively associated with the risk of type 2 diabetes (T2D) in Korean population. Additionally, CDKAL1 may not be associated with T2D onset over the age of 40. PMID: 28406950
  9. Our results suggest that rs6908425 in CDKAL1 is associated with the risk of developing SAPHO in Han Chinese populations. People who carry the risk allele T of rs6908425 might be more prone to developing SAPHO syndrome. PMID: 27936930
  10. We investigated the association between 8 single-nucleotide polymorphisms (SNPs) at 3 genetic loci (CDKAL1, CDKN2A/2B and FTO) with type 2 diabetes (T2D) in a Uyghur population PMID: 26873362
  11. our data suggested that CDKAL1 gene variants have a significant effect on the response to anti-TNF therapies among Psoriasis patients PMID: 26563541
  12. Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 PMID: 27049325
  13. rs10946398 associated with markers of impaired insulin secretion PMID: 26119585
  14. We observed novel selection signals in CDKAL1 and NEGR1, well-known diabetes and obesity susceptibility genes PMID: 25370040
  15. study found SNP rs7754840 in CDKAL1, rs864745 in JAZF1, and rs35767 in IGF1 might serve as potential susceptibility loci for type 2 diabetes in the Uyghur population PMID: 25785549
  16. The rs7754840 and rs7756992 SNPs of the CDKAL1 gene were found to be associated with Gestational Diabetes Mellitus in this south Indian population. PMID: 25723968
  17. study identified the association between type 2 diabetes risk variants in CDKAL1 and birthweight in Chinese Han individuals, and the carrier of risk allele within SRR had the trend of reduced birthweight. PMID: 26168825
  18. Provide evidence against a role for dysregulated expression of CDKAL1-v1 in mediating the association between intronic SNPs in CDKAL1 and susceptibility to type 2 diabetes. PMID: 25634229
  19. The results support a central role of CDKAL1 and TCF7L2 in T2DM susceptibility in Southwest Asian populations and provide a plausible component for understanding molecular mechanisms involved in the disease. PMID: 25483131
  20. CDKAL1 gene rs7756992 A/G polymorphism was significantly associated with T2DM. The person with G allele of CDKAL1 gene rs7756992 A/G polymorphism might be predisposed to T2DM. PMID: 24185407
  21. rs7756992 of CDKAL1 gene have a protective effect against diabetic nephropathy. PMID: 24636221
  22. Variants in CDKAL1 are associated with glucose-induced GIP and insulin response. PMID: 25222615
  23. Meta-analysis indicated significant association between the IGF2BP2 rs4402960 and CDKAL1 rs7756992 polymorphisms and increased risk of diabetes in Arab populations.[meta-analysis] PMID: 24898818
  24. CDKAL1-v1-mediated suppression of CDKAL1 might underlie the pathogenesis of type 2 diabetes in individuals carrying the risk Single-nucleotide polymorphisms. PMID: 24760768
  25. This study reports association of CDKAL1-related SNPs with insulin resistance, a clinical marker related to type 2 diabetes in a cross-sectional cohort of Greek children and adolescents of European descent. PMID: 24695378
  26. Data indicate the potential importance of CDKAL1 protein and homeobox protein HHEX in glucose homeostasis in this Alaska Native population with a low prevalence of type 2 diabetes (T2D). PMID: 24112421
  27. Five of these 14 loci had single-nucleotide polymorphisms in European studies while the other nine were different. Further stepwise conditional analysis identified seven secondary signals and an independent novel locus at the 3' end of CDKAL1. PMID: 24013783
  28. Substantiation of the roles of CAMK1D and CDKAL1 in gluconeogenic and glyconeogenic pathways in primary human hepatocytes. PMID: 23840313
  29. Evidence for a significant contribution of CDKN2A/B gene rs10811661 and CDKAL1 gene rs7756992 and rs10946398 to type 2 diabetes.[meta-analysis] PMID: 24012816
  30. TCF7L2 was replicated in this study (P = 0.004; combined analysis P = 3.8 x 10(-6)), and type 2 diabetes SNPs at or near CDKAL1, CDKN2A/B, and IGF2BP2 were associated with CFRD PMID: 23670970
  31. CDKAL1 may affect such compensatory mechanisms regulating glucose homeostasis through interaction with diet PMID: 23173044
  32. CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) is a tail-anchored protein in the endoplasmic reticulum (ER) of insulinoma cells. PMID: 23048041
  33. rs7754840 (CDKAL1) was associated in the nonobese type 2 diabetic subgroup, and for rs7903146 (TCF7L2), association was observed for early-onset type 2 diabetes. PMID: 22923468
  34. None of the 12 SNPs in the six genes (KCNJ11, TCF7L2, SLC30A8, HHEX, FTO and CDKAL1) uncovered in the genome-wide association studies were associated with polycystic ovary syndrome. PMID: 22443257
  35. Our findings indicated that genetic variants of CDKAL1 and VEGFA on chromosome 6 may contribute to T2D risk in Chinese population. PMID: 22437209
  36. The associations between SNPs of TCF7L2, CDKAL1, SLC30A8 and HHEX and the development of DR and DN. PMID: 22487833
  37. CDKAL1 might influence the level of glycosylated hemoglobin PMID: 22290723
  38. A significant association between Type 2 Diabetes Mellitus, an increased Fasting Plasma Glucose and rs7754840 at CDKAL1 in lean Han Chinese. PMID: 21643948
  39. CDKAL1 rs7754840 and rs7756992, but not CDKN2A/2B rs10811661, are associated with T2DM in Lebanese. PMID: 22119613
  40. Common variants at CDKAL1 and KLF9 are associated with body mass index in east Asian populations. PMID: 22344221
  41. Six SNP(rs7754840 in CDKAL1, rs391300 in SRR, rs2383208 in CDKN2A/2B, rs4402960 in IGF2BP2, rs10830963 in MTNR1B, rs4607517 in GCK)risk alleles of type 2 diabetes were associated with GDM in pregnant Chinese women. PMID: 22096510
  42. Variants in cdkal1 gene have been reproducibly associated with decreased first-phase insulin secretion and development of type 2 diabetes. PMID: 21908934
  43. CDKAL1 is involved in the pathogenesis of T2 diabetes through impaired beta-cell function. PMID: 21611789
  44. Single nucleotide polymorphism (SNP) analysis revealed that the sequence variant (rs5015480) near HHEX and two SNPs (rs7756992 and rs9465871) in CDKAL1 were associated with the susceptibility of type 2 diabetes mellitus in females, but not in males. PMID: 21368910
  45. Single nucleotide polymorphisms in CDKAL1 have no association with polycystic ovary syndrome or related clinical features in Chinese women. PMID: 19718565
  46. no relationship of CDKAL1 and KCNQ1 polymorphisms to the earlier onset of type 2 diabetes was observed PMID: 21416855
  47. Interaction between the CDKAL1 polymorphism and dietary energy intake influences the dysglycemic phenotype leading to MetS, possibly through impaired insulin secretion. The CDKAL1 polymorphism may be a marker for MetS in the Japanese population. PMID: 20847106
  48. there are significant associations between CDKAL1 polymorphisms and type 2 diabetes [meta-analysis] PMID: 20568056
  49. Data report a novel association between the fetal ADCY5 type 2 diabetes risk allele and decreased birthweight, and confirm in meta-analyses associations between decreased birthweight and the type 2 diabetes risk alleles of HHEX-IDE and CDKAL1. PMID: 20490451
  50. Studies identified significant association between variants in CDKN2A/B, CDKAL1 and TCF7L2, and type 2 diabetes in a Han Chinese cohort, indicating these genes as strong candidates conferring susceptibility to type 2 diabetes across different ethnicities. PMID: 20161779

Show More

Hide All

Involvement in disease
Diabetes mellitus, non-insulin-dependent (NIDDM)
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
Methylthiotransferase family, CDKAL1 subfamily
Tissue Specificity
Expressed in pancreatic islets.
Database Links

HGNC: 21050

OMIM: 125853

KEGG: hsa:54901

STRING: 9606.ENSP00000274695

UniGene: Hs.657604

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×