Recombinant Human Thromboxane-A synthase (TBXAS1)

Code CSB-CF023261HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TBXAS1
Uniprot No.
Alternative Names
TBXAS1; CYP5; CYP5A1; TXAS; Thromboxane-A synthase; TXA synthase; TXS; Cytochrome P450 5A1; Hydroperoxy icosatetraenoate dehydratase
Species
Homo sapiens (Human)
Expression Region
1-533
Target Protein Sequence
MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFR QGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSV ADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQR CYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLA RILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIV RDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATN PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCL GVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the conversion of prostaglandin H2 (PGH2) to thromboxane A2 (TXA2), a potent inducer of blood vessel constriction and platelet aggregation. Cleaves also PGH2 to 12-hydroxy-heptadecatrienoicacid (12-HHT) and malondialdehyde, which is known to act as a mediator of DNA damage. 12-HHT and malondialdehyde are formed stoichiometrically in the same amounts as TXA2. Additionally, displays dehydratase activity, toward (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate (15(S)-HPETE) producing 15-KETE and 15-HETE.
Gene References into Functions
  1. RS41708TT is not only independent risk factor for symptomatic carotid artery or intracranial arterial stenosis, but is also independent risk predictor for neurologic deterioration in ischemic stroke patients. PMID: 28108096
  2. Sequencing revealed two novel biallelic variants of unknown significance within the thromboxane A synthase gene, TBXAS1 (c.266T > C; c.989T > C), bioinformatically predicted to disrupt the protein. TBXAS1 mutations result in Ghosal hematodiaphyseal dysplasia (OMIM 231095), the autosomal recessive syndrome associated with abnormal bone structure and BMF. PMID: 28868793
  3. TXAS1 rs2267679TT and rs41708TT genotypes are associated with carotid plaque vulnerability, platelet activation and TXA2 levels in ischemic stroke patients. PMID: 28704403
  4. the administration of salted drinking water (2.7% NaCl) to wild-type mice resulted in elevated placental TXA2 synthase (TXAS) and plasma thromboxane A2, but not prostacyclin, levels, which was also found in clinical preeclampsia placenta samples. PMID: 26974824
  5. Single nucleotide polymorphisms of TBXAS1 are associated with susceptibility to gout in ethnic Han males population. PMID: 26252103
  6. The cardiovascular events significantly morefrequently occurred during 12 and 18 months in resistant diabetics and in the patients with an allele lacking the *2/*3 CYP2C9 gene function and AT/TT polymorphism of the thromboxane synthase gene TBS1. PMID: 26117917
  7. The carriage of Thromboxane A synthase 1 gene polymorphism AA was shown to affect the risk of clopidogrel resistance. PMID: 26027242
  8. study suggests that the anti-tumor effect of glycyrrhizin in lung adenocarcinoma is, at least in part, TxAS-dependent. PMID: 24556579
  9. 12-HHT is produced by both TxAS-dependent and TxAS-independent pathways in vitro and in vi PMID: 24009185
  10. In this study we have showed, for the first time, a significant role of the minor allele rs6962291 of TBXAS1 in patients with NSAID acute cutaneous hypersensitivity. PMID: 23763970
  11. The increased Km and decreased Vmax values observed with L357V suggest that this variant may generate less TXA2 at the low levels of PGH2 expected in vivo, raising the possibility of attenuated signaling through the thromboxane pathway. PMID: 22735388
  12. Data show that that DNA methylation of the TBXAS1 promoter was decreased and thromboxane synthase expression was increased in omental arteries of preeclamptic women as compared with normal pregnant women. PMID: 22493072
  13. these results showed that visfatin promoted IL-8 production by upregulation of TXAS, leading to angiogenic activation in endothelial cells. PMID: 22293189
  14. Rs10487667 polymorphism in the CYP5A1 gene might be a risk factor of myocardial infarction in the Uigur population in Xinjiang. PMID: 21215134
  15. Data suggest that targeting thromboxane synthase alone, or in combination with conventional chemotherapy is a potential therapeutic strategy for NSCLC. PMID: 21388528
  16. The rare allele of rs6962291 may play a protective role against aspirin hypersensitivity via a lower catalytic activity of the TBXAS1 gene, attributed to the increase of a nonfunctioning isoform of TBXAS1. PMID: 21449675
  17. The TC genotype and T allele of thromboxane synthase are risk factors of myocardial infarction. PMID: 20931532
  18. Apoptosis induced in lung cancer cells by the thromboxane synthase inhibitor 1-benzylimidazole is associated with the over-production of ROS and the reduction of NF-kappaB. PMID: 20647010
  19. In humans, TXAS was expressed in the atherosclerotic lesion, associated with increased inflammatory cells, in particular M2 polarized macrophages, and increased in atherosclerotic lesions of patients with recent symptoms of thrombotic events. PMID: 20383787
  20. Gene transfer of thromboxane A(2) synthase and prostaglandin I(2) synthase antithetically altered tumor angiogenesis and tumor growth. PMID: 11782360
  21. Transcriptional control of the human thromboxane synthase gene in vivo and in vitro. PMID: 11956185
  22. structure and function of the gene and protein - review PMID: 12432933
  23. Cox-2 and TBXAS may play an important role in pituitary tumor development and progression PMID: 15067173
  24. Significantly higher expression of thromboxane synthase is associated with metastasis in non-small cell lung cancer PMID: 15870920
  25. Overexpression of thromboxane synthase is associated with invasive bladder cancer PMID: 16357168
  26. Thromboxane synthase mutations in an increased bone density disorder (Ghosal syndrome). PMID: 18264100
  27. TBXAS1 genetic variation is associated with incident myocardial infarction. PMID: 19046748
  28. The results suggest specific TBXAS1 gene polymorphisms may be a useful marker for development of cerebral infarction, especially SAO type in Korean population. PMID: 19403042

Show More

Hide All

Involvement in disease
Ghosal hematodiaphyseal dysplasia (GHDD)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Cytochrome P450 family
Tissue Specificity
Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.
Database Links

HGNC: 11609

OMIM: 231095

KEGG: hsa:6916

UniGene: Hs.520757

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1