Recombinant Human Toll-like receptor 10 (TLR10), partial

Code CSB-CF023600HU
Abbreviation Recombinant Human TLR10 protein, partial
MSDS
Size $878
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Alternative Names
TLR10; UNQ315/PRO358; Toll-like receptor 10; CD antigen CD290
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
20-576aa
Target Protein Sequence
DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWPETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.1kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Gene References into Functions
  1. polymorphism in the TLR10 gene seems to increase the risk of post-bronchiolitis asthma in preschool-aged children PMID: 28592890
  2. rs4129009 polymorphism increased the risk of persistent asthma continuing from five to seven years of age until 11-13 years of age and increased the risk of needing inhaled corticosteroids at 11-13 years of age PMID: 28692144
  3. The TLR10 992AA genotype might increase and TLR10 720CC genotype might decrease susceptibility to pathogenesis of Crimean Congo hemorrhagic fever (CCHF) disease. TLR 10 polymorphisms may be also an important biomarker for CCHF susceptibility and fatality rate. PMID: 28843003
  4. Our results indicate that the presence of TLR10 rs10004195, A/T heterozygous, and T/T homozygous genotypes is associated with type 1, 2, and 3 whereas that of the A/A homozygous genotype is associated with type 4 and 5 of gastric mucosal patterns. This suggests that the A/A homozygous genotype contributes to severe inflammation in H. pylori-associated gastritis in Thai patients. PMID: 28699598
  5. data show increased TLR10 gene/protein expression in the adipose tissue in obesity/type-2 diabetes (T2D) which relates directly with BMI; data also show that ROS-mediated oxidative stress could induce expression of TLR10 in monocytic cells through the mechanism that involves NF-kappaB and MAPK signaling pathways and the ER stress response PMID: 29428931
  6. A TLR10 allelic variant, I473T, has impaired NFkB inhibitory activity and is highly associated with disease severity and low response to infliximab in patients with rheumatoid arthritis PMID: 27716427
  7. The data demonstrate that TLR10 is a novel regulator of innate immune responses and of the differentiation of primary human monocytes into effective dendritic cells. PMID: 28235773
  8. these results demonstrate that TLR10 functions as a broad negative regulator of TLR signaling PMID: 27022193
  9. Our results demonstrate that TLR10 has a functional role within the B cell lineage that is distinct from that of other TLR family members PMID: 27956526
  10. Study concludes that genetic variation in the TLR10-TLR1-TLR6 gene cluster mediates responsiveness to organic dust, but indicates different signaling pathways for IL-6 and TNF-alpha. These studies provide new insight into the role of the TLR10-TLR1-TLR6 gene cluster and the innate immune response to organic dust. PMID: 28123183
  11. Our results suggest that TLR10 is involved in the recognition of FSL-1, LPS, and flagellin and TLR-ligand-induced expression of TNF-alpha does not depend on TLR10. PMID: 27258267
  12. Data indicate that polymorphisms in toll like receptor 10 (TLR10) are not associated with chronic Q fever. PMID: 26364993
  13. Study annotated variants at 4p14 as expression quantitative trait loci (eQTL) associated with TLR6/10 and FAM114A1; findings suggest that 4p14 polymorphisms are linked to host immune response to H. pylori infection but not to its acquisition. PMID: 26312625
  14. concluded that TLR-1 rs4833095 and TLR10 rs10004195 confer susceptibility to development of gastroduodenal disease, especially GC in H.pylori disease PMID: 26559190
  15. genetic variants in TLR10 are associated with protection against complicated skin and skin structure infections PMID: 25895985
  16. TLR1 rs4833095 and TLR10 rs10004195 may play crucial roles in H. pylori susceptibility and gastric pathogenesis. PMID: 25687912
  17. Our results suggest that TLR10 polymorphisms may contribute to the pathogenesis of autoimmune thyroid diseases. PMID: 25295614
  18. single nucleotide polymorphism (SNP) in TLR10 (rs11096957) is associated with risk for Tuberculosis PMID: 25857634
  19. Genetic variation rs5743565 in TLR1 might be associated with the decreased susceptibility to Graves disease, whlie polymorphisms in TLR6 and TLR10 did not reach the statistical significance. PMID: 25028161
  20. The correlation between TLR1, TLR6, and TLR10 polymorphisms and the development of atopic dermatitis in the Republic of Bashkortostan has been found. PMID: 25850295
  21. The results suggest roles for TLR3, TLR10, PLAT (n=2), VEGFA and DENND1B in susceptibility to chronic cavitary pulmonary aspergillosis. PMID: 24712925
  22. TLR10 is a modulatory pattern-recognition receptor with mainly inhibitory properties PMID: 25288745
  23. Toll-like receptor 10 is involved in induction of innate immune responses to influenza virus infection. PMID: 24567377
  24. CCL20, CCL1, & IL-8 were reduced following TKR10 knockdown. TLR10 silencing increased viability of L. monocytogenes in both HT-29 & THP-1 cells. TLR10 senses pathogenic infection in both intestinal epithelium & macrophages. PMID: 24198280
  25. data indicate novel roles for TLR10 in sensing pathogenic infection in both the epithelium and macrophages and have identified L. monocytogenes as a source of ligand for the orphan receptor TLR10. PMID: 24198280
  26. promotes trophoblast apoptosis triggered by gram-positive bacterial components PMID: 23279063
  27. The study shows that genetic variation within the TLR10/1/6 locus is the major common genetic factor explaining interindividual variation in TLR1/2-mediated cytokine responses. PMID: 23151486
  28. Allelic variants in TLR10 gene is associated with bilateral affectation and clinical course of Meniere's disease. PMID: 23370977
  29. genetic association study in a population in Republic of Korea: Data suggest that SNP in TLR10 (rs11466653; T allele, Met326Thr) is associated with development of papillary thyroid carcinoma with small tumor size (<1 cm). PMID: 23124277
  30. Statistical differences have been found in TLR10 (rs4129009) gene between low and high tumor infiltration stage. PMID: 22504414
  31. The results showed that the genetic markers in TLR1, TLR4, TLR5 TLR6, and TLR10 were associated with the occurrence of acute Graft-versus-host disease following hematopoietic stem cell transplantation PMID: 22703024
  32. genetic variation in TLR10 plays a role in interindividual differences in CD susceptibility and clinical outcome. PMID: 22342453
  33. No significant differences are found in the TLR3 and TLR10 genotypes or allele distribution between rheumatoid arthritis patients and control individuals. PMID: 20422193
  34. absence of the common haplotype in the TLR10-TLR1-TLR6 gene cluster increases the risk of developing chronic disease in patients already affected by sarcoidosis. PMID: 22150367
  35. Case-control analysis showed that the TLR10 gene single nucleotide polymorphism rs10004195 was associated with immunoglobulin A nephropathy (IgAN) in Korean children. Results suggest that TLR10 gene may be associated with susceptibility to IgAN. PMID: 20953797
  36. Pam(3)CSK(4) is the ligand for the hTLR10/2 complex and PamCysPamSK4 activates hTLR10/1 hetero and hTLR10 homodimer. PMID: 20877634
  37. genetic polymorphism association with allergic rhinitis in asthma in a Chinese population PMID: 20815312
  38. Analysis of chimeric receptors containing the TLR10 extracellular recognition domain indicates that human TLR10 cooperates with TLR2 in sensing of microbes and fungi but possesses a signaling function distinct from that of other TLR2 subfamily members. PMID: 20348427
  39. in reproductive tract, expression is restricted to Fallopian tube PMID: 19406482
  40. IL-13/IL-4 and TLR-10 might be involved in the genetics of preterm births. PMID: 19332998
  41. TLR10 is a potential asthma candidate gene. TLR10 genetic variation contributes to asthma risk. PMID: 15201134
  42. Unlike TLR1 and TLR6, TLR10 is expressed in a highly restricted fashion as a highly N-glycosylated protein, which is detected in B cell lines, B cells from peripheral blood, and plasmacytoid dendritic cells from tonsil. PMID: 15728506
  43. The observed multiple associated SNPs at the TLR6-TLR1-TLR10 gene cluster were dependent and suggest the presence of a founder prostate cancer risk variant on this haplotype background. PMID: 15812078
  44. We genotyped 19 common (>5%) haplotype-tagging SNPs chosen from the SNPs discovered in a resequencing study spanning TLR6, TLR1, and TLR10 to test for the association between sequence variants cluster and prostate cancer. PMID: 17932345
  45. The TLR10 structure is in good agreement with available biochemical data on TLR receptors and is likely to provide a good model for the physiological dimer. PMID: 18332149
  46. common haplotype in the TLR10-TLR1-TLR6 gene cluster influences prostate cancer risk and clearly supports the need for further investigation of TLR genes in other populations PMID: 18752252

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Toll-like receptor family
Tissue Specificity
Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.
Database Links

HGNC: 15634

OMIM: 606270

KEGG: hsa:81793

STRING: 9606.ENSP00000308925

UniGene: Hs.120551

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*