Recombinant Human Trace amine-associated receptor 6 (TAAR6)

Code CSB-CF857018HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TAAR6; TA4; TAR4; TRAR4; Trace amine-associated receptor 6; TaR-6; Trace amine receptor 6; Trace amine receptor 4; TaR-4
Species
Homo sapiens (Human)
Expression Region
1-345
Target Protein Sequence
MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHF KQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSL FHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEEL SDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTES SSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCA YYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood.
Gene References into Functions
  1. Among the 15 SNPs and seven haplotypes of TAAR6, rs7772821 (T>G) on the 3'-UTR showed the strongest correlation with inhaled corticosteroid-induced %DeltaFEV1 in asthmatics. PMID: 25919112
  2. The results of this study suggested a possible role of TAAR6 in antidepressant response and suicide behavior in patients with depressive disorder PMID: 20493543
  3. an epistastic effect between a set of TAAR6 and HSP-70 gene variations has a role in major mood disorders PMID: 19582769
  4. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20493543
  5. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 19643584
  6. TRAR4 is preferentially expressed in those brain regions that have been implicated in the pathophysiology of schizophrenia. PMID: 15329799
  7. Analysis of haplotype blocks revealed no significant association of the TRAR4 region with schizophrenia. PMID: 16189505
  8. This study strongly support association of the TAAR6 gene with susceptibility to both schizophrenia and bipolar disorder in Korean patients. PMID: 17097106
  9. The trace amine associate receptor 6 (TAAR6) gene is associated with schizophrenia in the Irish study of high-density schizophrenia families.( PMID: 17505468
  10. although data do not provide evidence for an altered receptor activity of this TA4 polymorphism, an involvement in bipolar affective disorder cannot be excluded based on our in vitro data PMID: 17895926
  11. No association of trace amine receptor genes with bipolar disorder. PMID: 17957234
  12. We reported an association between TAAR6 (trace amine associated receptor 6 gene) variations and schizophrenia (SZ). We now report an association of a set of TAAR6 variations and clinical presentation and outcome in a sample of 240 SZ Korean patients. PMID: 18583103
  13. Trace amine associated receptor 6 is not important for the development of schizophrenia in our family samples. PMID: 18628684
  14. Here we demonstrate that TAAR6 is not associated with schizophrenia in the ICCSS sample. PMID: 18973992
  15. Analysis of epistasis between a set of variations located in the TAAR6 and HSP-70 genes found weak associations with the risk of psychosis and response to antipsychotic treatment PMID: 19643584
  16. This study provides preliminary evidence that HSP-70 may play a role in the disrupted mechanisms that lead to BPD. PMID: 19766166
  17. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 19766166
  18. Observational study of gene-disease association. (HuGE Navigator) PMID: 19345712
  19. Observational study of gene-disease association. (HuGE Navigator) PMID: 18973992
  20. Observational study of gene-disease association. (HuGE Navigator) PMID: 18978678
  21. Observational study of gene-disease association. (HuGE Navigator) PMID: 18628684
  22. Observational study of gene-disease association. (HuGE Navigator) PMID: 18583103
  23. Observational study of gene-disease association. (HuGE Navigator) PMID: 18198266
  24. Observational study of gene-disease association. (HuGE Navigator) PMID: 16075187
  25. Observational study of gene-disease association. (HuGE Navigator) PMID: 17097106
  26. Observational study of gene-disease association. (HuGE Navigator) PMID: 17505468
  27. Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines. PMID: 16878137

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expr
Database Links

HGNC: 20978

OMIM: 608923

KEGG: hsa:319100

STRING: 9606.ENSP00000275198

UniGene: Hs.434196

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1