Recombinant Human Translocator protein (TSPO)

Code CSB-CF025168HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TSPO; BZRP; MBR; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
Species
Homo sapiens (Human)
Expression Region
2-169
Target Protein Sequence
APPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides.
Gene References into Functions
  1. An increase in the expression levels of Tspo mRNA is not necessarily a good diagnostic biomarker in most cancers with changes not being large enough to be significantly different when detected by in situ hybridisation. PMID: 30044440
  2. Suggest that altered TSPO distribution in the cerebellum, and potentially in other regions (e.g. the hippocampus), may be a marker of pathophysiology in systemic lupus erythematosus. PMID: 27387599
  3. Effects of genetic variants in the TSPO gene on protein structure and stability PMID: 29641545
  4. PET study found increased TSPO availability, suggestive of predominantly microglial activation, in the anterior cingulate cortex during a moderate to severe major depressive episode. A potential contribution of suicidality to the elevated TSPO in major depressive disorder warrants further research in adequately powered studies. PMID: 28939116
  5. Study found significantly lower levels of activated microglia in the brains of living alcohol dependent subjects compared to healthy controls as measured with [11C]PBR28 PET. Importantly, exploratory analyses suggest that lower [11C]PBR28 VT values are associated with greater alcohol dependence severity and more reported drinks per day over the previous month. PMID: 28242869
  6. Authors investigate the function of TSPO in cholesterol efflux from the RPE cells. We demonstrate in RPE cells that TSPO specific ligands promoted cholesterol efflux to acceptor (apo)lipoprotein and human serum, while loss of TSPO resulted in impaired cholesterol efflux. PMID: 28973423
  7. suggest that both of the most important proapoptotic and anticancer proteins, p53 and TSPO PMID: 26378498
  8. Study shows that fibromyalgia patients with the translocator protein high affinity binding genotype reported a higher pain intensity and more severe fibromyalgia symptoms compared to mixed/low affinity binders, and this was modulated by interaction with the serotonin transporter gene. PMID: 27448744
  9. Genome-wide significant (GWS) associations in single-nucleotide polymorphism (SNP)-based tests (P < 5 x 10(-8)) were identified for SNPs in PFDN1/HBEGF, USP6NL/ECHDC3, and BZRAP1-AS1. PMID: 28183528
  10. TSPO mutations in rats and a human polymorphism impair the rate of steroid synthesis. PMID: 29074640
  11. Findings suggest lower glial density or an altered activation state with lower TSPO expression in the hippocampus of alcohol dependent patients. PMID: 28072413
  12. demonstrate a consistent down-regulation of TSPO mRNA and protein in macrophages activated to a pro-inflammatory, or 'M1' phenotype PMID: 28968465
  13. These findings have important implications for understanding the biology of TSPO in activated macrophages and microglia in humans. PMID: 28530125
  14. TSPO may serve a range of functions that can be viewed as downstream regulatory effects of its primary, evolutionary conserved role in cell metabolism and energy production. PMID: 28103132
  15. We report for the first time, to our knowledge, the kinetic properties of the novel third-generation TSPO PET ligand (18)F-GE180 in humans: 2TCM4k is the optimal method to quantify the brain uptake, 90 min is the optimal scan length, and the Logan approach could be used to generate parametric maps. Although these control subjects have shown relatively low VT, the methodology presented here forms the basis for quantificati PMID: 27261523
  16. demonstrate rapid decrease in TSPO binding to the high affinity site induced by exposure to cigarette smoke PMID: 27939322
  17. Study shows that TSPO's mitochondrial functions include modulation of nuclear gene expression via mitochondrial-nuclear signaling which can suggests whereby TSPO can control several vital cell functions, which has major implications for the whole organism in health and disease. PMID: 28387723
  18. TSPO is an ancient bacterial receptor/stress sensor that has developed additional interactions, partners, and roles in its mitochondrial outer membrane environment in eukaryotes. PMID: 27074410
  19. Unlike the strictly mitochondrial localisation of PBR/TSPO, PBR-S (isoform which lacks exon 2) has a punctate distribution throughout the cytosol that co-localises with lysosomes in HeLa, HEK-293, MDA-MB-231, BJ and U87-MG cells. PMID: 28263860
  20. [(18)F]PBR102 and [(18)F]PBR111 have distinct metabolic profiles in rat and non-human primates. Radiometabolites contributed to non-specific binding and confounded in vivo brain analysis of [(18)F]PBR102 in rodents; the impact in primates was less pronounced. Both [(18)F]PBR102 and [(18)F]PBR111 are suitable for PET imaging of TSPO in vivo. In vitro metabolite studies can be used to predict in vivo radioligand metabolism PMID: 27699720
  21. the epigenetic regulation of TSPO PMID: 28004979
  22. the effects of PK11195 on meningioma were associated the decrease of allopregnanolone biosynthesis, which was mediated by TSPO. PMID: 26835706
  23. Study demonstrates that TSPO has an anti-inflammatory role in endothelial activation through the inhibition of VCAM1 and regulation of mitochondrial function in endothelial cells. PMID: 26608360
  24. Study focuses on the current understanding of TSPO interplay with reactive oxygen species and the voltage-dependent anion channel to which it binds, in the regulation of cell mitophagy. [review] PMID: 26551691
  25. The authors discuss findings about TSPO and its function in the steroidogenesis which are inconclusive at this time. [Review] PMID: 26551695
  26. Studies confirmed that TSPO expression increases with tumor grade in astrocytomas but also that some overlap exists between Low-grade and anaplastic lesions. PMID: 26551696
  27. This work implicates TSPO in the maintenance of mitochondrial membrane integrity and in the control of mitochondrial ROS production, ultimately favoring tissue regeneration. PMID: 27054921
  28. differential expression in children with allergic asthma PMID: 25979194
  29. We conclude that ScBsAbAgn-2/TSPO targeting of glioblastoma cell lines can be achieved in vitro and in vivo. PMID: 26898800
  30. Exposure of cells to CS resulted in alternation of biomolecules expressed by CLs peroxidation, reduction of TSPO binding, and depletion of the mitochondrial potential. This irreversible damage was enhanced in the presence of saliva PMID: 25968977
  31. Study show that TSPO is highly expressed in human glioma and correlates with grade and represents a promising target in human glioma imaging for detection and staging. PMID: 26517124
  32. Elevations in microglial activity can be measured in vivo with positron emission tomography (PET) using radioligands specific for the 18kD translocator-protein (TSPO), which is expressed on microglia. PMID: 26472628
  33. Our preliminary results suggest that TSPO brain imaging in GBM may be a useful tool for predicting tumor progression at follow-up and may be less susceptible to changes in blood-brain barrier permeability than (18)F-FET. PMID: 26182972
  34. Data suggest that TSPO expression is tightly associated with metabolic state of adipocytes and differentiation of preadipocytes into white/brown adipocytes; TSPO expression may improve metabolic status of adipocytes and regulate glucose homeostasis. PMID: 26123521
  35. Our findings highlight TSPO as a candidate for future investigations of antipsychotic-induced weight gain, and support the involvement of mitochondrial membrane components in this serious treatment side effect. PMID: 25560467
  36. TSPO is a biomarkers that can predict recovery from brain injury and myocarditis PMID: 25123025
  37. Data indicate that variation in the translocator protein (18 kDa) (TSPO) gene affects susceptibility to topic dermatitis (AD). PMID: 24998961
  38. This study identifies key cholesterol binding enhancement motif in translocator protein 18 kDa. PMID: 25635829
  39. Results show that TSPO is involved in cell death induction by NH4Cl; TSPO ligands, depending on their concentration, bimodally modulated NH4Cl-induced toxicity PMID: 24168369
  40. As demonstrated within a group of stroke and GBM patients, (123)I-CLINDE SPECT can be used for quantitative assessment of TSPO expression in vivo PMID: 25453044
  41. it appears that 10(-5) M FGIN-1-27 reduces cell viability, cell metabolism, and mitochondrial function. PMID: 24532136
  42. TSPO expression is able to distinguish differences in the severity of myocarditis between male subjects and female subjects. PMID: 24402571
  43. Increased TSPO expression and microglial activation are not associated with cocaine abuse. PMID: 25057196
  44. Data indicate that targeting 18 kDa translocator protein (TSPO) reduces macrophage lipid content and prevents macrophage foam cell formation. PMID: 24814875
  45. These findings suggest that TSPO is highly expressed in reactive retinal microglia and a promising target to control microglial reactivity during retinal degeneration. PMID: 24397957
  46. Both IRF-4 and IBP might be involved in the pathogenesis of psoriasis vulgaris. PMID: 22528235
  47. XBD173 blockade provides a practical means of estimating VND for TSPO targeting radioligands. PMID: 24643083
  48. data indicate a nominal association between the rs6971 SNP in the TSPO gene and the diagnosis of BD. PMID: 23942012
  49. The mitochondrial TSPO protein inhibits HIV-1 envelope glycoprotein biosynthesis via the endoplasmic reticulum-associated protein. degradation pathway PMID: 24403586
  50. PET imaging with [11C]PBR28 in subjects with mild-to-moderate depression and C-reactive protein levels <5 mg/L do not show that depressed subjects have neuroinflammation or microglial activation. PMID: 23850810

Show More

Hide All

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
TspO/BZRP family
Tissue Specificity
Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids.
Database Links

HGNC: 1158

OMIM: 109610

KEGG: hsa:706

STRING: 9606.ENSP00000328973

UniGene: Hs.202

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1