Recombinant Human Sigma intracellular receptor 2 (TMEM97)

Code CSB-CF023900HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TMEM97; MAC30; S2R; Sigma intracellular receptor 2; Sigma-2 receptor; Sigma2 receptor; Meningioma-associated protein 30; Transmembrane protein 97
Species
Homo sapiens (Human)
Expression Region
1-176
Target Protein Sequence
MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Intracellular orphan receptor that binds numerous drugs and which is highly expressed in various proliferating cancer cells. Corresponds to the sigma-2 receptor, which is thought to play important role in regulating cell survival, morphology and differentiation. Under investigation for its potential diagnostic and therapeutic uses. May play a role as a regulator of cellular cholesterol homeostasis. May function as sterol isomerase. May alter the activity of some cytochrome P450 proteins.
Gene References into Functions
  1. we not only confirmed the elevated MAC30 mRNA, but also demonstrated that GC with overexpression of MAC30 resisted to adjuvant platinum-based chemotherapy. PMID: 28972404
  2. TMEM97 possesses the full suite of molecular properties that define the sigma2 receptor, and Asp29 and Asp56 are essential for ligand recognition PMID: 28559337
  3. MAC30 could be a useful biomarker of tumor differentiation and outcome of patients with non-small cell lung cancer. Overexpression of MAC30 predicts a worse tumor differentiated stage and prognosis in patients with non-small cell lung cancer receiving adjuvant chemotherapy. PMID: 27688262
  4. Study generated a series of sigma1R and sigma2R/Tmem97 agonists and antagonists and tested them for efficacy in the mouse spared nerve injury model. Results show robust antineuropathic pain effects of sigma1R and sigma2R/Tmem97 ligands, demonstrate that sigma2R/Tmem97 is a novel neuropathic pain target, and identify sigma2R/Tmem97 agonist UKH-1114 as a lead molecule for further development. PMID: 28644012
  5. knockdown of TMEM97 also increases levels of residual NPC1 in NPC1-mutant patient fibroblasts and reduces cholesterol storage in an NPC1-dependent manner. Our findings propose TMEM97 inhibition as a novel strategy to increase residual NPC1 levels in cells and a potential therapeutic target for Niemann-Pick type C disease (NP-C). PMID: 27378690
  6. Overexpression of MAC30 is associated with Squamous Cell Carcinomas of the Lung. PMID: 27268655
  7. High expression of TMEM97 is associated with glioma. PMID: 26002575
  8. The down-regulation of MAC30 expression efficiently inhibited the proliferation of gastric cancer cells. Furthermore, the mobility of gastric cancer cells was also inhibited by down-regulation of MAC30. PMID: 24853233
  9. MAC30 may serve as a new molecular marker to predict the lymph node metastasis and prognosis of patients with epithelial ovarian cancer PMID: 23254963
  10. Overexpression of MAC30 is associated with non-small-cell lung cancer. PMID: 23229099
  11. As the tumor penetrated the wall of the colon/rectum, MAC30 mRNA expression notably increased in colorectal tumors with T3+T4 stage compared to tumors with T1+T2 stage. PMID: 22024687
  12. expression of MAC30 in the cytoplasm markedly increased from normal oral epithelial cells to primary oral squamous cell carcinoma; MAC30 expression in primary tumors with lymph node metastasis exceeded levels in those without metastasis PMID: 21079401
  13. MAC30 mRNA and protein expression in normal and cancerous tissue samples of the esophagus, stomach, colon and pancreas PMID: 15375745
  14. MAC30 protein may play a role in development of colorectal cancer, and can be considered as a prognostic factor. PMID: 17143516
  15. The most up-regulated gene was TMEM97 which encodes a transmembrane protein of unknown function (MAC30). PMID: 18070364

Show More

Hide All

Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Rough endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
TMEM97/sigma-2 receptor family
Tissue Specificity
Widely expressed in normal tissues. Expressed in pancreatic, renal, breast, colon, ovarian surface epithelial (OSE) cells. Highly expressed in various proliferating cancer cells.
Database Links

HGNC: 28106

OMIM: 612912

KEGG: hsa:27346

STRING: 9606.ENSP00000226230

UniGene: Hs.199695

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1