Recombinant Human Tricarboxylate transport protein, mitochondrial (SLC25A1)

Code CSB-CF021475HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Citrate transport protein; CTP; mitochondrial; SLC20A3; Slc25a1; solute carrier family 20 (mitochondrial citrate transporter), member 3; solute carrier family 25 (mitochondrial carrier, citrate transporter), member 1; Solute carrier family 25 member 1; Tricarboxylate carrier protein; Tricarboxylate transport protein; tricarboxylate transport protein, mitochondrial; TXTP_HUMAN
Species
Homo sapiens (Human)
Expression Region
14-311
Target Protein Sequence
APASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQ TVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGV AEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGS NQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEA HKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Citrate transporter that mediates the exchange of mitochondrial citrate for cytosolic malate. Also able to mediate the exchange of citrate for isocitrate, phosphoenolpyruvate, cis- but not trans-aconitate and to a lesser extend maleate and succinate. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway. Required for proper neuromuscular junction formation.
Gene References into Functions
  1. SLC25A1 and ACLY upregulation suggests that metabolic reprogramming in Behcet's syndrome involves the citrate pathway dysregulation. PMID: 30050389
  2. tested the expression specificity of the Cochlin-tomoprotein by testing blood and CSF samples. The concentration was below the detection limit (0.2 ng/ml) in 38 of the 40 blood, and 14 of the 19 CSF samples PMID: 29377917
  3. Pathogenic mutations of the human mitochondrial citrate carrier SLC25A1 lead to impaired citrate export required for lipid, dolichol, ubiquinone and sterol synthesis. PMID: 29031613
  4. this study shows increased expression of SLC25A1 gene in cells from children with Down syndrome PMID: 27502741
  5. Altered metabolism in 22qDS reflected a critical role for the haploinsufficiency of the mitochondrial citrate transporter SLC25A1, further enhanced by HIF-1alpha, MYC, and metabolite controls. PMID: 26221035
  6. we report for the first time on a patient with a genetically confirmed diagnosis of SLC25A1 deficiency and treatment with either malate or citrate PMID: 24687295
  7. SLC25A1 has a key role in TNF-alpha and IFNgamma induced inflammation and is induced at the transcriptional level by these two inflammation mediators cytokines. PMID: 25072865
  8. We report for the first time a patient with a mitochondrial citrate carrier deficiency. Our data support a role for citric acid cycle defects in agenesis of corpus callosum PMID: 23393310
  9. Compares and contrasts all the known human SLC25A* genes and includes functional information. PMID: 23266187
  10. Deficiency in SLC25A1, encoding the mitochondrial citrate carrier, causes combined D-2- and L-2-hydroxyglutaric aciduria. PMID: 23561848
  11. The mitochondrial citrate carrier (CIC) is present and regulates insulin secretion by human male gamete. PMID: 22355067
  12. muscular symptoms of CTP deficiency respond to creatine supplementation PMID: 21660517
  13. The mitochondrial citrate carrier: a new player in inflammation PMID: 21787310
  14. The results of molecular cloning of a citrate transporter from human normal prostate epithelial PNT2-C2 cells, is reported. PMID: 20448665
  15. Results suggest an evolutionary conserved role for Sea/SLC25A1 in the regulation of chromosome integrity. PMID: 19654186
  16. These results show that methylation, histone acetylation and Sp1 are important in the transcriptional regulation of the CIC proximal promoter. PMID: 18706393
  17. These results show that FOXA plays a role in the transcriptional regulation of CIC and in insulin secretion. PMID: 19445897
  18. CIC silencer activity extends over 26 bp (-595/-569), which specifically bind a protein ZNF224 present in HepG2 cell nuclear extracts. PMID: 19505435

Show More

Hide All

Involvement in disease
Combined D-2- and L-2-hydroxyglutaric aciduria (D2L2AD)
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Database Links

HGNC: 10979

OMIM: 190315

KEGG: hsa:6576

STRING: 9606.ENSP00000215882

UniGene: Hs.111024

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1