Recombinant Human Uncharacterized protein C4orf52 (C4orf52)

Code CSB-CF843271HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SMIM20
Uniprot No.
Alternative Names
SMIM20; C4orf52; MITRAC7; Small integral membrane protein 20; Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 7 kDa; MITRAC7
Species
Homo sapiens (Human)
Expression Region
1-168
Target Protein Sequence
MVKEVWRVLREEPGRRKESRQNRARGNRVQQNSSNLNPTPAPGPHSTESRGRRRAGSEAP PRPGSESLSTSSERGHGPAVGNLVSESAGRSAGQGSPGPDAMSRNLRTALIFGGFISLIG AAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. Promotes the progression of complex assembly after the association of MT-CO1/COX1 with COX4I1 and COX6C. Chaperone-like assembly factor required to stabilize newly synthesized MT-CO1/COX1 and to prevent its premature turnover.; Peptide involved in a broad spectrum of regulatory functions. Is a ligand for GPR173. As part of the reproductive cycle, it regulates gonadotropin-releasing hormone (GnRH) signaling in the hypothalamus and pituitary gland which augments the release of luteinizing hormone. Plays a protective role in memory retention through activation of GNRHR. Regulates the secretion of AVP by hypothalamic neurons. Plays a role in the transduction of the itch sensation. Induces anxiolytic effects, reducing behavior associated with anxiety. Regulates food intake as well as satiation and satiety. In the ovary, it regulates follicular growth by stimulating granulosa cell proliferation by increasing the expression of GPR173, CREB1, CYP19A1, KITLG, FSHR, and LHCGR. It also increases the production of estradiol (E2). In the heart, it regulates contractility and relaxation. It also plays a cardioprotective role during ischemia, where it activates the SAFE and RISK pathways. Stimulates the proliferation and differentiation of preadipocytes. In pancreatic islet cells, it induces proliferation of islet cells as well as the production of INS.; Peptide involved in a broad spectrum of regulatory functions. Is a ligand for GPR173. As part of the reproductive cycle, it regulates gonadotropin-releasing hormone (GnRH) signaling in the hypothalamus and pituitary gland which augments the release of luteinizing hormone. Plays a protective role in memory retention through activation of GNRHR. Regulates the secretion of AVP by hypothalamic neurons. Plays a role in the transduction of the itch sensation. Induces anxiolytic effects, reducing behavior associated with anxiety. Regulates food intake as well as satiation and satiety. In the ovary, it regulates follicular growth by stimulating granulosa cell proliferation by increasing the expression of GPR173, CREB1, CYP19A1, KITLG, FSHR, and LHCGR. It also increases the production of estradiol (E2). In the heart, it regulates contractility and relaxation. It also plays a cardioprotective role during ischemia, where it activates the SAFE and RISK pathways. Stimulates the proliferation and differentiation of preadipocytes. In pancreatic islet cells, it induces proliferation of islet cells as well as the production of INS.
Gene References into Functions
  1. MITRAC7 affects the biogenesis pathway by stabilizing newly synthesized COX1 in assembly intermediates, concomitantly preventing turnover. PMID: 26321642
  2. SMIM20 (MITRAC7) is a COX1 specific chaperone which is necessary for cytochrome c oxidase biogenesis. PMID: 26321642
Subcellular Location
[Small integral membrane protein 20]: Mitochondrion inner membrane; Single-pass membrane protein.; [Phoenixin-14]: Secreted.; [Phoenixin-20]: Secreted.
Tissue Specificity
Expressed in the ovary, specifically in granulosa cells of follicles that have passed the primary stage and in oocytes (at protein level).
Database Links

HGNC: 37260

OMIM: 617465

KEGG: hsa:389203

STRING: 9606.ENSP00000427407

UniGene: Hs.479386

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1