Recombinant Human Uracil nucleotide/cysteinyl leukotriene receptor (GPR17)

Code CSB-CF619758HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GPR17
Uniprot No.
Alternative Names
GPR17; Uracil nucleotide/cysteinyl leukotriene receptor; UDP/CysLT receptor; G-protein coupled receptor 17; P2Y-like receptor; R12
Species
Homo sapiens (Human)
Expression Region
1-367
Target Protein Sequence
MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENM LFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHF SGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLAC AFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCY LLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQ RILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESS LSAKSEL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dual specificity receptor for uracil nucleotides and cysteinyl leukotrienes (CysLTs). Signals through G(i) and inhibition of adenylyl cyclase. May mediate brain damage by nucleotides and CysLTs following ischemia.
Gene References into Functions
  1. In silico and ex vivo validation experiments provided the deep understanding of ligand binding with GPR17 and the present findings reported here may lead to use these two compounds as a potential activator of GPR17 for therapeutic intervention. PMID: 28827203
  2. Results show a crucial role of SNX27 in modulating GPR17 levels by means of a post-translational mechanism and highlights the relationship between the trafficking of the receptor through the endomembrane system and oligodendrocyte differentiation; and provide novel evidence of impairment of GPR17 expression and oligodendrocyte maturation in a mouse model of Down syndrome that is characterized by SNX27 down-regulation. PMID: 27270750
  3. uracil nucleotides and cysteinyl leukotrienes do not activate human, mouse, or rat GPR17 in various cellular backgrounds. PMID: 28254957
  4. GPR17 gene disruption does not alter food intake or glucose homeostasis in mice. PMID: 25624481
  5. This review summarizes knowledge about role of GPR17 receptors in physiology and pathology of nervous system, with special attention to remyelination processes. PMID: 25807830
  6. Low levels of GRK2/GRK5 causes a slow and not complete desensitization/down-regulation of GPR17. PMID: 24613411
  7. Data indicate that small molecule MDL29,951 activates human, mouse and rat orphan G protein-coupled receptor GPR17. PMID: 24150254
  8. Data validate GPR17 as a target for neurorepair PMID: 23801362
  9. Nucleotides, nucleotide sugars, and cysteinyl leukotrienes do not promote activation of GPR17 in five different cell lines, nor does GPR17 have signaling properties. PMID: 23908386
  10. analysis of agonist-induced trafficking of native GPR17 in oligodendroglial cells PMID: 23288840
  11. A functional cross-talk exists between cysteinyl-leukotriene and purinergic sites at GPR17; the latter have a hierarchy in producing desensitizing signals. PMID: 21531793
  12. REVIEW: functional properties and in vivo biology PMID: 21261596
  13. We present the first isoform-specific characterization of GPR17 and show that differences exist between the isoforms in expression pattern and pharmacological profile; the two human isoforms might serve tissue-specific functions PMID: 20148890
  14. GPR17, a Gi-coupled orphan receptor at intermediate phylogenetic position between P2Y and CysLT receptors, is specifically activated by both families of endogenous ligands. PMID: 16990797
  15. Molecular dynamics simulations suggest that GPR17 nucleotide binding pocket is similar to that described for the other P2Y receptors, although only one of the 3 basic residues that have been typically involved in ligand recognition is conserved (Arg255). PMID: 18533035
  16. long-GPR17 isoform is a functional receptor that is stimulated by both uracil nucleotides and cysteinyl leukotrienes PMID: 19625605

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in brain, kidney, heart and umbilical vein endothelial cells. Highest level in brain.
Database Links

HGNC: 4471

OMIM: 603071

KEGG: hsa:2840

STRING: 9606.ENSP00000272644

UniGene: Hs.46453

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1