Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF848385HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q8TAA9 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGND STRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLG LLVFLTPIAFILLPPILWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMP RVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVL LELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKF RAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKAR LVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSM ESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIV FVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV |
| Source | in vitro E.coli expression system |
| Gene Names | VANGL1 |
| Protein Names | Recommended name: Vang-like protein 1 Alternative name(s): Loop-tail protein 2 homolog Short name= LPP2 Strabismus 2 Van Gogh-like protein 1 |
| Expression Region | 1-524 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Involvement in disease | Neural tube defects (NTD); Sacral defect with anterior meningocele (SDAM) |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Vang family |
| Tissue Specificity | According to PubMed:11956595, ubiquitously expressed. According to PubMed:12011995, expressed specifically in testis and ovary. |
| Database Links |
HGNC: 15512 OMIM: 182940 KEGG: hsa:81839 STRING: 9606.ENSP00000310800 UniGene: Hs.515130 |
| Pathway | Wnt signaling pathway |
VANGL1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA025787GA01HU | VANGL1 Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA004418 | VANGL1 Antibody | Human,Mouse | WB,ELISA |
| CSB-PA698804 | VANGL1 Antibody | Human,Mouse | ELISA,WB,IHC |
| CSB-PA936526 | VANGL1 Antibody | Human,Mouse | ELISA,WB,IHC |
VANGL1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA848385ESR1HU | VANGL1 Antibody | Human | ELISA, WB, IHC |
VANGL1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP848385HU1 CSB-EP848385HU1 CSB-BP848385HU1 CSB-MP848385HU1 |
Recombinant Human Vang-like protein 1(VANGL1),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Sheep Tumor necrosis factor(TNF),partial,partial
Express system: Yeast
Species: Ovis aries (Sheep)
Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Visinin-like protein 1(VSNL1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Immunoglobulin J chain(Jchain)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Integrin alpha-IIb(ITGA2B),partial
Express system: E.coli
Species: Homo sapiens (Human)
