Recombinant Human Vang-like protein 1(VANGL1)

Code CSB-CF848385HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8TAA9
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGND STRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLG LLVFLTPIAFILLPPILWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMP RVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVL LELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKF RAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKAR LVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSM ESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIV FVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV
Source in vitro E.coli expression system
Gene Names VANGL1
Protein Names Recommended name: Vang-like protein 1 Alternative name(s): Loop-tail protein 2 homolog Short name= LPP2 Strabismus 2 Van Gogh-like protein 1
Expression Region 1-524
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Involvement in disease Neural tube defects (NTD); Sacral defect with anterior meningocele (SDAM)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Vang family
Tissue Specificity According to PubMed:11956595, ubiquitously expressed. According to PubMed:12011995, expressed specifically in testis and ovary.
Database Links

HGNC: 15512

OMIM: 182940

KEGG: hsa:81839

STRING: 9606.ENSP00000310800

UniGene: Hs.515130

Pathway Wnt signaling pathway

Related Products

VANGL1 Antibodies

VANGL1 Antibodies for Homo sapiens (Human)

VANGL1 Antibodies for Human

VANGL1 Proteins

VANGL1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.