Recombinant Human Vang-like protein 2(VANGL2)

Code CSB-CF890750HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9ULK5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTR GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV
Source in vitro E.coli expression system
Gene Names VANGL2
Protein Names Recommended name: Vang-like protein 2 Alternative name(s): Loop-tail protein 1 homolog Strabismus 1 Van Gogh-like protein 2
Expression Region 1-521
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. Plays a role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. Required for polarization and movement of myocardializing cells in the outflow tract and seems to act via RHOA signaling to regulate this process. Required for cell surface localization of FZD3 and FZD6 in the inner ear (By similarity).
Involvement in disease Neural tube defects (NTD)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Vang family
Database Links

HGNC: 15511

OMIM: 182940

KEGG: hsa:57216

STRING: 9606.ENSP00000357040

UniGene: Hs.99477

Pathway Wnt signaling pathway

Related Products

VANGL2 Antibodies

VANGL2 Antibodies for Homo sapiens (Human)

VANGL2 Antibodies for Human

VANGL2 Proteins

VANGL2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.