Recombinant Human Vasoactive intestinal polypeptide receptor 1(VIPR1)

Code CSB-CF025859HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P32241
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence ARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIF KLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGY GLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFDSGESDQCSE GSVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGVPSTFT MVWTIARIHFEDYGCWDTINSSLWWIIKGPILTSILVNFILFICIIRILLQKLRPPDIRK SDSSPYSRLARSTLLLIPLFGVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVAILYCF LNGEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSF QAEVSLV
Source in vitro E.coli expression system
Gene Names VIPR1
Protein Names Recommended name: Vasoactive intestinal polypeptide receptor 1 Short name= VIP-R-1 Alternative name(s): Pituitary adenylate cyclase-activating polypeptide type II receptor Short name= PACAP type II receptor Short name= PACAP-R
Expression Region 31-457
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Pe
Database Links

HGNC: 12694

OMIM: 192321

KEGG: hsa:7433

STRING: 9606.ENSP00000327246

UniGene: Hs.348500

Related Products

VIPR1 Antibodies

VIPR1 Antibodies for Homo sapiens (Human)

VIPR1 Proteins

VIPR1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.