Recombinant Human Vesicle-associated membrane protein 2(VAMP2)

Code CSB-CF025781HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P63027
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence SATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Source in vitro E.coli expression system
Gene Names VAMP2
Protein Names Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): Synaptobrevin-2
Expression Region 2-116
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane
Protein Families Synaptobrevin family
Tissue Specificity Nervous system and skeletal muscle.
Database Links

HGNC: 12643

OMIM: 185881

KEGG: hsa:6844

STRING: 9606.ENSP00000314214

UniGene: Hs.25348

Pathway Secreted Extracellular Vesicles
Synaptic vesicle cycle

Related Products

VAMP2 Antibodies

VAMP2 Antibodies for Homo sapiens (Human)

VAMP2 Antibodies for Human

VAMP2 Proteins

VAMP2 Proteins for Homo sapiens (Human)

VAMP2 ELISA Kit

VAMP2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.