Recombinant Human Voltage-dependent calcium channel gamma-2 subunit (CACNG2)

Code CSB-CF896926HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CACNG2; Voltage-dependent calcium channel gamma-2 subunit; Neuronal voltage-gated calcium channel gamma-2 subunit; Transmembrane AMPAR regulatory protein gamma-2; TARP gamma-2
Species
Homo sapiens (Human)
Expression Region
1-323
Target Protein Sequence
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH NCIQKENKDSLHSNTANRRTTPV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
Gene References into Functions
  1. TARP gamma-2 reduces the ability of low glutamate concentrations to cause AMPAR desensitization and enhances channel gating at low glutamate occupancy. PMID: 28768197
  2. Our nanopositioning data place stargazin below the AMPA receptor ligand-binding domain, where it is well poised to act as a scaffold to facilitate the long-range conformational selection observations seen in single-molecule experiments. These data support a model of stargazin acting to stabilize or select conformational states that favor activation. PMID: 27705782
  3. In addition to changes in MEK3 gene regulation, our study demonstrated upregulation of CACNG2 and GADD45G at the mRNA level in CMM patients. PMID: 27418173
  4. A transient positive feedback mechanism between AMPAR and stargazin has implications for information processing in the brain, because it should allow activity-dependent facilitation of excitatory synaptic transmission through a postsynaptic mechanism. PMID: 26744192
  5. The additional cleft closure and/or stabilization of the more closed-cleft states of the LBD is expected to translate to higher agonist efficacy and could contribute to the structural mechanism for stargazin modulation of AMPAR function. PMID: 25422502
  6. Autoinactivation is a subunit and splice form dependent property of AMPA receptor-stargazin complexes, which involves structural rearrangements within the complex rather than any physical dissociation. PMID: 23166629
  7. Susceptibility to chronic pain following nerve injury is genetically affected by CACNG2 PMID: 20688780
  8. These results suggest that stargazin (gamma-2) not only promotes AMPA receptor surface expression but also directly modulates AMPA receptor activity. PMID: 15567474
  9. AMPA receptors complexed with stargazin are significantly more responsive to synaptically released glutamate compared with AMPA receptors lacking stargazin. PMID: 15758178
  10. Stargazin enhances trafficking of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors GluR1 and GluR2 by blocking endoplasmic reticulum retention. PMID: 16793768
  11. the Q/R site modulates the interaction of stargazin with the transmembrane domains of AMPA receptors via an allosteric mechanism and that this modulation leads to the observed differences in the electrophysiological properties of the receptor PMID: 17483093
  12. Stargazin polymorphisms may play a role in the response to lithium treatment. PMID: 18408563
  13. The genes CACNG2 might be vulnerability genes for neuropsychologically defined subgroups of schizophrenic patients. PMID: 18571626
  14. findings show stargazin demonstrates differential control of AMPA receptor subunit stability PMID: 19543281
  15. Data show that S-nitrosylation of stargazin increases binding to the AMPAR subunit GluR1, causing increased surface expression of the AMPAR. PMID: 19805317

Show More

Hide All

Involvement in disease
Mental retardation, autosomal dominant 10 (MRD10)
Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Tissue Specificity
Brain.
Database Links

HGNC: 1406

OMIM: 602911

KEGG: hsa:10369

STRING: 9606.ENSP00000300105

UniGene: Hs.146766

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1