Recombinant Human Zinc transporter ZIP4 (SLC39A4)

Code CSB-CF747413HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SLC39A4
Uniprot No.
Alternative Names
SLC39A4; ZIP4; Zinc transporter ZIP4; Solute carrier family 39 member 4; Zrt- and Irt-like protein 4; ZIP-4
Species
Homo sapiens (Human)
Expression Region
23-647
Target Protein Sequence
SPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCANGPCGKCLSVEDALGLGEPEGSGL PPGPVLEARYVARLSAAAVLYLSNPEGTCEDARAGLWASHADHLLALLESPKALTPGLSW LLQRMQARAAGQTPKTACVDIPQLLEEAVGAGAPGSAGGVLAALLDHVRSGSCFHALPSP QYFVDFVFQQHSSEVPMTLAELSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNS SSVWDTVCLSARDVMAAYGLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLS QSERYLYGSLATLLICLCAVFGLLLLTCTGCRGVTHYILQTFLSLAVGALTGDAVLHLTP KVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLEDGPCGHSSHS HGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPELLNPEPRRLSPELRLLPYMITL GDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALLLN LASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPWLLFL LHNVGLLGGWTVLLLLSLYEDDITF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in cellular zinc homeostasis as a zinc transporter. Regulated in response to zinc availability.
Gene References into Functions
  1. Results showed decreased expression of Zn uptake transporters ZIP2 and ZIP4 on mRNA and protein level correlating with SHANK3 expression levels, and found reduced levels of ZIP4 protein co-localizing with SHANK3 at the plasma membrane. ZIP4 exists in a complex with SHANK3. Further results confirmed a link between enterocytic SHANK3, ZIP2 and ZIP4. PMID: 28345660
  2. Expression of zinc transporters ZIP4, ZIP14 and ZnT9 in hepatic carcinogenesis-An immunohistochemical study PMID: 29895370
  3. exosomal ZIP4 promotes cancer growth and is a novel diagnostic biomarker for pancreatic cancer. PMID: 30007115
  4. Structural insights of ZIP4 extracellular domain critical for optimal zinc transport have been uncovered. PMID: 27321477
  5. ZIP4 regulates human epidermal homeostasis in patients with acrodermatitis enteropathica. PMID: 27940220
  6. ZIP4 and intracellular zinc have essential roles in tumoral growth in oral squamous cell carcinoma PMID: 28017725
  7. Case Report: heterozygote mutation in SLC39A4 resulting in acrodermatitis enteropathica. PMID: 26351177
  8. Data sho that silencing of zinc transporter ZIP4 resulted in increased bone tissue mineral density, and restoration of bone strength. PMID: 26305676
  9. Studied the zinc binding properties of the large intracellular loop of hZIP4. PMID: 25882556
  10. The results described a previously uncharacterized role of ZIP4 in apoptosis resistance and elucidated a novel pathway through which ZIP4 regulates pancreatic cancer growth. PMID: 24553114
  11. In glioma tumors, high ZIP4 expression was significantly associated with higher grade. PMID: 25921144
  12. Developed is a structural model of ZIP4 by combining protein prediction methods with in situ experiments. Insight into the permeation pathway of ZIP4 is provided. PMID: 25971965
  13. SLC39A4 mutations have roles in zinc deficiency PMID: 25391167
  14. Both acrodermatitis mutations cause absence of the ZIP4 transporter cell surface expression and nearly absent zinc uptake. PMID: 24586184
  15. ZIP4 activates the zinc-dependent transcription factor CREB and requires this transcription factor to increase miR-373 expression through the regulation of its promoter. PMID: 23857777
  16. High ZIP4 expression is associated with glioma. PMID: 23595627
  17. resulkts indicate ZIP4 is the only zinc transporter that is significantly up-regulated in pancreatic cancer and might be the major zinc transporter that plays an important role in pancreatic cancer growth PMID: 23331012
  18. The results suggest that ZIP4 may be a tumor suppressor gene and down-regulation of ZIP4 may be a critical early event in the development of prostate carcinoma PMID: 21803616
  19. Expression of two Zn(2+) influx transporters, ZIP2 and ZIP4, is reduced as a function of retinal pigment epithelium age. PMID: 21603979
  20. Zinc, copper(II), and nickel can be transported by human ZIP4 when the cation concentration is in the micromolar range; nickel can bind to but is not transported by human ZIP4. PMID: 22242765
  21. The transporter ZIP4 is expressed along the entire gastrointestinal tract and acts as a major processor of dietary zinc PMID: 21462106
  22. GSPE and EGCG enhance the expression of cellular zinc importers ZIP4 (SLC39A4). PMID: 20471814
  23. Cell migration assays revealed that RNAi knockdown of Zip4 in Hepa cells depressed in vitro migration whereas forced over-expression in Hepa cells and MCF-7 cells enhanced in vitro migration PMID: 20957146
  24. Zinc can regulate the mRNA expression of ZIP4 in Caco2 cells. PMID: 16986515
  25. Overexpression of ZIP4 caused significantly increased expression of NRP-1, VEGF, MMP-2 and MMP-9 and is associated with angiogenesis, invasion and metastasis pathways in pancreatic cancer. PMID: 20023433
  26. ZIP4 overexpression causes increased IL-6 transcription through CREB, which in turn activates STAT3 and leads to increased cyclin D1 expression PMID: 20160059
  27. A novel member of a zinc transporter family, hZIP4, is defective in acrodermatitis enteropathica. PMID: 12032886
  28. SLC39A4 is centrally involved in the pathogenesis of acrodermatitis enteropathica. PMID: 12068297
  29. Three novel mutations, 1017ins53, which creates premature termination codon, and two mis-sense mutations, R95C and Q303H. PMID: 12787121
  30. temporal and spatial patterns of expression of the mouse ZIP1, 3, 4, and 5 genes in the developing intestine and the effects of maternal dietary zinc deficiency on these patterns of expression were examined PMID: 16682017
  31. ubiquitin-mediated degradation of the ZIP4 protein is critical for regulating zinc homeostasis in response to the upper tier of physiological zinc concentrations. PMID: 17202136
  32. therapeutic strategy whereby ZIP4 is targeted to control pancreatic cancer growth PMID: 18003899
  33. Acrodermatitis enteropathica is a rare autosomal recessive disorder caused by mutations in SLC39A4, which encodes the tissue-specific zinc transporter ZIP4. PMID: 18328205
  34. the clinical manifestations in three acrodermatitis enteropathica patients with a novel mutation PMID: 19416242
  35. results suggest that exon 9 in the SLC39A4 gene encompassing c.1438G should be screened first in the molecular diagnosis of Japanese patients with Acrodermatitis Enteropathic. PMID: 19416256
  36. Knocking down ZIP4 by short hairpin RNA might be a novel treatment strategy for pancreatic cancers with ZIP4 overexpression. PMID: 19755388

Show More

Hide All

Involvement in disease
Acrodermatitis enteropathica, zinc-deficiency type (AEZ)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Note=Colocalized with TFRC in the recycling endosomes. Cycles between endosomal compartments and the plasma membrane in response to zinc availability.
Protein Families
ZIP transporter (TC 2.A.5) family
Tissue Specificity
Highly expressed in kidney, small intestine, stomach, colon, jejunum and duodenum.
Database Links

HGNC: 17129

OMIM: 201100

KEGG: hsa:55630

STRING: 9606.ENSP00000301305

UniGene: Hs.521934

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1